Alexandre FRANÇOIS LACITO‐CNRS, Paris;   Australian National University 

   

Structures et dynamiques des systèmes linguistiques Description, documentation, comparaison des langues océaniennes  

Travaux rassemblés en vue de  

l’Habilitation à Diriger des Recherches     

  Volume II   

PUBLICATIONS SCIENTIFIQUES Articles de revues à comité de lecture  Chapitres d’ouvrages   

 

2014      Institut National des Langues et Civilisations Orientales, Paris 

Alexandre FRANÇOIS Habilitation à Diriger des Recherches

Publications scientifiques : Articles et chapitres

Volume II – Publications scientifiques

Articles de revues à comité de lecture

Alexalldre FRANÇOIS

Bulleti" de la Société de linguistique

de Paris. /. XCIV (/999)./asc. 1. p. 437-486

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV ENTR E PHONOLOGIE ET MORPHOLOGIE

S OMM A IRE. Le seul article cOllsacré cl ce jour ail motlav (Kasarhéroll 1962) relevait. à la suite de Codrillglon. le phéllomèlle de la copie vocalique: certains préfixes verraielll leur voyelle systématiqu emellf assimilée à celle du radical - ex. na- + vôy > IlQ-vôy. Nous montrOIlS d'abord qlle celle règle Ile cOllcem e que la moilié du lexique, les radicaux de f orme CV-, tandis que les alllres (ell CCV-) remplacelll celle voyelle clollée par ulle voyelle fixe, sans copie. Après ulle hYI)othèse diachronique pour expliquer celle bipartition du lexique ell deux gralldes classes morphologiques (CV- vs. CCV-), le système phonologique est réanalysé en syllchrollie, suggérant de

nouveaux ollliis théoriques pOlir représenter/es /aits observés. Ainsi, dans une approche Gillosegmentale, Ja Ilolion de «phollème flottol1l »

est réactualisée pour relldre compte du comportemelll de ces préfixes, et s'a vère également f écollde pour expliquer IIIl autre phéllomène du mo tla v, le transf ert vocalique - ex. na- + hinag > ni-hnag. Enfin , l'illsertion syllabique (mtig > mitig) donlle la clef de lOut le système, ell permellant de transférer parmi les règles phonologiques des f ormes qui semblaient d 'abord relever de la /l1O/phologie.

Le motlav est une langue mélanésienne parlée au nord du Vanuatu (Banks) dans l'île de Motalava (Motlav), par une communauté de 1500 locute urs environ: ce chiffre en fait la langue la plus parlée dans la région des Banks, qui en totalise une bonne di zaine. Parmi cellesci, se trouve aussi le mota, qui fut longtemps le mieux documenté de tous les parlers de cette région, grâce à la remarquable description qu'en a fournie le Révérend Codrington (bibliogr. 1885, 1896). Ces infonnations, unies à des données de première main que nous avons recuei ll ies dans les îles Banks au cours de l'année 1998, nous permettront de comparer les faits motlav avec ceux des langues voisines. Le motlav nous a d 'emblée frappé par la complexité de sa phonologie et de sa morphologie. Pourtant , cette complexité semblait pouvoir se ramener à une poignée de règles facilement manipulables, per·

438

MOUV EMENTS ET CLONAGES DE VOYELLES EN MOTLA V

ALEXANDRE FRANÇOIS

439

mellant de calculer sans erreur toutes les formes qu'exige la pratique de la langue: les formes irrégulières, pléthoriques au premier regard, se ramènent presque toujours à des régularités secondaires, en sorte qu'il est apparu possible, quoique laborieux, de dresser l'intégralité de ce système morphophonologique à l'aide de quelques règles et

Mis à part ces réalisations en distribution complémentaire, aucun phénomène phonologique remarquable ne concerne les consonnes: en particulier, on ne relève aucun cas d'assimilation entre consonnes, adjacentes ou non.

catégories en nombre limité.

1.2 Voyelles

Or, c'est sur la distribution et l'interdépendance des voyelles que semble reposer l'essentiel de ce système. C'est du moins par ce biaislà que nous choisissons de le présenter, tant celle approche semble féconde aussi bien pour la compréhension du motlav lui-même, que pour la réflexion théorique qu'elle autorise.

C'est un système symétrique à sept voyelles phonologiques; Codrington (1885: 311) n' en avait vu que cinq. On a uniquement des monophtongues orales. i

u

Ilêl

L Phonologie générale du motlav

u lôr

e

0

a

1.1 Co"so""es Le motlav présente 16 phonèmes consonantiques, tous susceptibles d 'apparaître dans n' importe .quelle position de la chaîne (initiale 1 fin de syllabe). Le tableau ci-dessous les récapitule, indiquant en même temps l'usage orthographique, lequel obéit au principe: un phonème, un graphème. Celle convention entend s'adapter aux règles très strictes qui régissent l'allribution, à chaque consonne, d'une position unique sur un squelette syllabique.

Si la réalisation phonétique de III et luI met en œuvre le trait ATR, reste à savoir si celui-ci est pertinent au niveau phonologique: est-il justifié de poser une opposition binaire entre i, Il d'un côté, ê, ô de l'autre, ou bien doit-on voir dans le tableau simplement 4 crans d'aperture distribués en deux séries (antérieures 1postérieures)? Nous répondrons bientôt à cette question 1.

1.3 Structure syllabique labiol'8.

bi/ab.

kp' l'II

DCCl. sO IlJ'de,f

Dccl. sOI/ores pré/JOs.

mb Ibl

fricatives sourdes fric . sonores

v

u/l'lo/.

l'lIa irt

1

k

Ad kil

s

nasales

'lm"" l,fil

lo/érale semi-consollnes

w

III

phar)'lIg.

h

y 181 n 1 j Iyl

D ln!

Seuls deux schémas de syllabe sont possibles en motlav: (Cl V et (Ç)VC, avec un penchant marqué pour CVc. Ainsi, excepté dans quelques emprunts, les groupes de (deux) consonnes ne sont autorisés que si ces consonnes peuvent se distribuer sur deux syllabes différentes: -VCIIIC,V-. En outre, deux consonnes identiques sont prononcées comme une seule consonne simple, sans gémination. No ne- myôs so lev

vi-

twag, ba

lSG STAT vouloir C1C prendre CAR D un

Les deux phonèmes Iwl et Ijl ont un statut purement consonantique. D' autre part, on notera les principales réalisations phonétiques de quelques-unes de ces consonnes, en fonction de leur position dans la syllabe : phonème

init;tlle

intervocalique

fin de syllabe

/vi l'dl rb!

vd-

-v-

-p

.nd_

b-

·"'b-

-n -m

nêk et bus

te b i Yi b Yi fi

mais 2sG ne vouloir pas aider(2)

no.

Iso Je vell.x en prendre tm, mais tu ne veux pas m'aider.

La chaîne syntactique s'organise exclusivement en deux types de syllabes, (C)V et (C)VC: no Ine-m Iyô- Iso lIe- Ivi-t Iwag lb. Inêlk etl bus Ite Ibilyiblyifilno 1. Voir §2.1.

440

441

ALEXANDRE FRANÇOIS

MOUVEMENTS ET C LONAGES DE VOYELLES EN MOTLAV

Cette structuration syllabique exerce des contraintes fortes sur toutes la morphologie du motlav, contraintes qui seules permettent de rendre compte, en synchronie. des règles présidant à l'agencement des unités lex icales dans le discours. En outre, il faut noter une certaine tendance du motlav, du moins en apparence, à év iter les suites de syllabes ouvertes au sein du même mot morphologique : une suite de plus de deux syllabes [C,Y ,IC,V,IC3Y3(C)] sera presque systématiquement syncopée en [C, Y(l)C,IC3y 3(C)] :

assimilation totale, mais d ' une modification partielle, qui n'apparaît dans cette langue que dans un cas très particulier, que l'on va voir.

*Ie- Igelmcl · > le-glmel dans lIakamal > au nakamaf. dan s la maison des hommes

II est difficile de décider a priori si cette syncope est un événement aya nt eu lieu dans la diachronie de la langue, où si l'on doit y voir une règle phonologique vivante et productive: nous en reparlerons'-

2. La distribution des voyelles dans le mot De nombreuses questions se posent au sujet de la distribution des voyelles parmi les syllabes d'un mot, particulièrement dans les cas d 'affixation . En fait, il faut distinguer quatre classes de phénomènes morphologiques "/00 phonologiques portant sur les voyelles : -

-

harmQnie vocalique: au sein d'un lexème, la flex ion d'une voyelle entraîne une assimi lati on partielle de la voye lle précédente : hlu-k «mon copain» > êvlô-n «son copain»); copie vocalique; sans disparaître, la voye lle radica le tran smet son timbre à la voye lle du préfixe : na- + wôl > nQ-wôl « lune»; transfert yoca lique : la voyelle radicale transmet son timbre à la

voyelle du préfixe, puis disparaît na- + hinag > ni-hnag ê

yênti-

nièce

ê>e

ivê.... tale'"

mère

e>a 'a u >ô

moyu-

Isg

3sg yêntê-n

âme

yênti-k ivê·k tale-k

oncle 1 neveu

moyu-k

moyô-n

ive-" tala-n

A noter, les voyelles arrondies ne s'ouvrent pas forcément: v. jonct.

thème

0-0

10'

ô :;; ô u=u

swô.... ni· bgu""

sens mémoire noyau péché

Isg

..

li-k

ni-bgu-k

3sg lo-n swô-n ni -bgu-n

S'il est vrai que cette ouverture d'un degré s'explique sans doute, historiquement, par le timbre vocalique disparu des anciens suffixes (PNCy3 Isg '-kil , 3sg '-/la), ce n'est pas là, cependant, qu ' il faut parler d'harmonie vocalique: en synchronie, il ne s 'agit plus de l'influence d'une voyelle sur une autre, mais de flexions associées à des paradigmes morphologiques. Mais la première conclusion que nous pouvons tirer de ce tableau est d'ordre phonologique, car elle concerne la structuration des phonèmes vocaliques entre eux. On sait en effet que IiI s 'oppose à /l/=ê, tout comme luI à lul=ô, par deux traits phonétiques principaux: d'une 3. PNC V pour Proto North-Central Vanuatu , sous-groupe de l'ensemble océanien. Cf. Clark (t 985).

442

443

ALEXANDRE FRANÇDlS

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV

part l'aperture (i est plus femlé que ê), ce qui les place dans une échelle à 4 termes i-ê-e-a ... ; d 'autre part le trait ATR (i est +ATR, ê est -ATR), qui quant à lui situe les deux phonèmes i et ê l' un par rapport à l'autre, en couple. Une question légitime en phonologie serait: lequel de ces deux traits est emie? Autrement d it, quel trai t a été retenu par le motlav pour structurer le système des voyelles? Une première réponse est suggérée par le fonctionnement de cette flexion possessive des noms : l'ouverture d ' un cran de chacune des voyelles (dans l'ordre i > ê> e > a) tendrait à prouver que le motlav a retenu le critère d 'aperture comme principe d'organisation de son système vocalique, tandis que l'opposition etic [±AT R), n' aurait pas de pertinence au ni veau phonologique. Dans ce cas, et dans ce cas seulement, le système proposé par J. Kasarhérou (1 962) pour le motlav serait équi valent au nôtre, étant composé des seules voyelles [+ATR) li, e, E, a, ~, 0, u/: bien que l'observation soit phonétiquement fausse, eUe serait fonctionnellement correcte. Nous allons voir ce qu ' il en est.

Le premier de ces lableaux signale donc l' influence que peut avoir la modification d 'une voyelle d 'un mot sur d'autres voyelles du même mot. Dans un tel cas de figure, cependant, on ne peut parler slrictement d'une copie vocalique, puisque Vi ne remplace pas Vi' sous quelque forme que ce soit ; en revanche, elle lui transmet bel et bien, à travers le mur des consonnes, une de ses caractéristiques. Quelle est donc cette caractéristique, régissant la transformation commune de i et Il en ê et ô respectivement? Et pourquoi cette altération conditionnée ne concerne-t-elle que ces deux paires de voyelles, et non toute la série i-ê-e-a? La réponse est suggérée par la question même: c'est sans équivoque le trait [±ATR) qui explique cette nouvelle règle phonologique_ En effet, alors que ce trait n'est pas en jeu dans les couples i-e ou i-a, c 'est lui qui oppose en bloc i-ll à ê-ô, et qui pennet d 'expliquer leur solidarité. On peut ainsi reconstituer les deux étapes du processus fa isant passer ivlu-k à êvlô-n, processus très instructi f pour comprendre l'organisation du système vocalique en motlav:

2.1.2 Harmonisation vocalique Or, un sous-ensemble de ces noms à possession , Ô, le trai t

[-ATR] de 6 s' impose à la voyelle précédente, dans la mesure où ce trait y est pertinent (donc pour i et Il seulement). Ai nsi · ivlô ~ n s'hM.: monise en ê vlô~n [tplun], forme dans laquelle les deux voyelles sont toutes les deux [-ATR] . Cette fois-ci, ce n'est plus l'aperture vocalique qui situe les phonèmes i et ê l'un par rapport à l'autre dans le système, mais ce fameux trait ATR,

C'est donc bien une véritable harmonisation - sinon harmonie ' vocalique qui a lieu ici, dans laquelle une voyelle passée' de [+ATR) à [-ATR) a exercé une contrainte sur d'autres voyelles du même mot, imposant le même passage de [+ATR) à [-ATR) _ Voilà qui donne une information précieuse sur la structuration du système vocalique de la langue: le trait [ATR). que l'on avait cru etic et non emie en motlav, se révèle en fait pertinent, dans la mesure où lui seul 4. On ne peUl pas parler d'hannonie [ATR ) au niveau phonologique en mOllav, comme on peut le faire pour d'autres langues, dans la mesure où d'aulres fonnes lexicales n'interd isent pas des divergences sur ce Irait : on a ai nsi régul ièrement rôti [Iuti) ou wêti [wltiJ. Mieux vau l donc parler d'harmonisatioll vocalique, comme fait de morphologie régissant la flex ion de quelques noms. 5. On pourrait discuter sur la primauté de Iso sur 350. M ais l'unité fléchie est un radical (ivlu .... ) qui pe Ul apparaître tel quel, et prouve donc qu 'on est bien passé de i- /I à ~-ô, et non l'inverse. D 'autre part. on sait que le i reflète un ancien article personnel IiI, confinnant que ivlu est premier par rapport à êvlô-.

445

ALEXANDRE FRANÇOIS

M OUVEMENTS ET CLONAGES DE VOYELLES EN MOTLA V

peut rendre compte de certai ns faits de morphologie, qui seraient mal expliqués si l'on se contentait de mentionner l'aperture. Outre cette information sur les structures du vocalisme, l'harmonisation en A TR nous intéresse pour la suite de notre étude sur les mouvements et influences entre voyelles dans le mot. Cette assimi lation partielle qu'est l' harmonisation, tout en ne concemant qu 'une classe restreinte de termes, révèle déjà une certaine perméabilité des voyelles aux caractéristiques phoniques de leur environnement. Indépendamment de la nature et du nombre des consonnes qui les séparent', les voyelles s' influencent les unes les autres, du moins dans certains cas particuliers bien circonscrits. Nous allons maintenant examiner d'autres phénomènes morphologiques plus importants, dans la mesure où ils portent sur des classes de mots bien plus nombreuses - aussi bien les noms que les verbes - , et impliquent des assimilations non plus partielles, mais totales, voire de véritables mouvements de voyelles.

nous montrerons que l'auteur a tort d'en tirer argument pour nier

444

2.2 Copie vocalique

La copie vocalique apparaît comme le phénomène le plus complexe de la morphologie du motl av , et en tout cas le plus marquant. Les affixes en jeu dans les cas de transfert et copie vocaliques sont les mêmes : il s' agit des préfixes variables nominaux na- ARTICLE, be«poun>, le- LOCATIF, les préfixes verbaux ne- STATtF, me- ACCOMPLI, te- FUTUR, enfin les translatifs te- ABLATIF et v- NUM. CARDINAL.

l'opposition verbo-nominale, pour la simple raison que ces deux préfixes sont en fait morphologiquement différents. On peut citer ainsi au hasard les formes suivantes, où l 'on cons ta-

tera une identité systématique entre la première voyelle, celle du préfi xe, et la sui vante, appa rtenant au radical: art .

*n* p-

.. ,

6. Nous mentionnerons plus tard (§2.2.6. 1) la représentation que propose la théorie autosegmentale, pou r de tels phénomènes: consonnes et voye lles sont disposées sur deux plans di st incts, autori sant la perméabilité des unes aux aut res, comme dans le cas de l 'harmonie. Cf. Angoujard ( 1997).

le pou la maladie les mouches

deux

nê-sêm nô-vôy ni-qti-k ve-vet

qualre

sur le volcan

bi -qt i-k

pour ma tête

"argen t le volcan ma tête

ne·qel nu-kumay

le tnro

nê-qtê-n

sa tête

vê-vêh to-Mot

combien?

patale douce

de M ota

Face à ceUe série parfaite, il est tentant de poser une règle générale de copie vocalique: tout préfixe de forme C- adopte la première voyelle du lexème auquel il s'applique, lorsque ce lexème commence par 1 (ou 2) consonne(s). C'est ai nsi que, selon J. Kasarhérou, ces préfixes «semblent ne pas avoir de voyelle propre, mais l'emprunter au rad ical». Il s'agirait alors d'une voyelle de tral/sitiol/ de timbre indéfini, apparaissant selon des règles d'organisation syllabique. En effet, en vertu des règles empêchan t strictement un groupe de consonnes en attaque de syllabe, chaq ue affixe C- ne pourrait se combiner à un lexème C(C)V- que moyennant des réajustements - le principe étant d'insérer une position syllabique entre deux consonnes, lorsque celles-ci ne peuvent pas se répartir entre deux syllabes distinctes. radical

2.2.1 Les préfixes *C- et la copie vocalique La copie de la voyelle a déjà été repérée par les deux seuls auteurs ayant déjà parlé du motlav : Codrington, en 1885, et Jacqueline Kasarhérou (de la Fontinelle), dans sa brève présentation «Les changements vocaliques de trois préfi xes en motlav» (1962), consacrée à ce sujet. Ces deux auteurs ont en commun de présenter ces préfixes comme phonologiquement de forme Co: Codrington parle ainsi de narticle des noms, n- préfixe verbal, m- marque verbale de passé et tde futur, en parlant à chaque fois de «vowel shifting ». Et c'est sous cette même forme que J. Kasarhérou les cite également, non sans réunir les deux n- en un seul «préfixe actualisant» accepté par tous les lexèmes, qu'ils équivalent à nos noms ou à nos verbes; à ce sujet,

ni-git no-go rn na-Ian vô-yô lô-vôy

Vî CV;-

ccv l -

+ radie. n-Yi" nVrICV;IlVr ClCY j * 11 -

1/0 111

seul

I/om + ar/icle

sel/s

ih

n-ih

arc

bê

nê-bê

eau

qti

ni-qti

tête

On opposerait ai nsi ces préfixes, morphologiquement de structure C(article *n-), à d'autres affixes véritablement CV-, qui d' une part ne s'élident pas, et, d'autre part, ne présentent jamais cette copie vocalique: -

le verba l ni- 3SG+lNACP: ni-;II (il) boit , IIi-et (il) voit, lIi-vall (i l) va, "i-suwslIW (i l) se baigne, ni-gen (i l) mange; les dérivatifs yo- feuille de (yo-mt;g palme de cocotier) ou \VO- fru it de (wo -mlig noix de coco);

-

l'article honorifique WO-, qui commute avec l'article *n- : wo-sêm la monnaie trad it ionnelle (/ nê-sêm), wO-IIgê ton visage (poétiqlle); (sans consonne initiale) le préfi xe locatif a- , apparaissant tel quel dans plusieurs toponymes (a-Vllô Lat' Van ua Lava, a-Gô Gaua, a-Mew Maewo ... ) et adverbes circonstantiels (0 -1011 dedans, a-Igiy derrière 1 après, a-qyig aujourd'hui .. .), ele.

446

ALEXANDRE FRANÇOIS

Cependant, on va voir que cette ex plication en tcnnes de soutien syllabique, pourtant judicieuse pour rendre compte d'autres phénomènes, n'est pas adéquate dans le cas de ces préfi xes à copie vocalique.

2,2,2 Préfixes CV -: nature de la voyelle V En réalité, plusieurs arguments plaiden t pour qu'on pose des préfi xes CV- et non C-; reste à savoir s' il fa ut poser une voyelle «copiante » indéfinie (e central, archiphonème vocalique), ou une véritable voyelle phonologique, différente selon les morphèmes. On citera d'abord le nom de la tortue, na-o, qui sans article se réd uit 11 0: bien qu'exceptionnelle - on attendait *n-o - , cette forme prouve qu 'on ne peut poser un article sous forme C- (soit on-l, mais qu 'il peut apparaître pourvu d'une voyelle, y compris dans un cas où la structure syllabique ne requiert aucune voyelle de transition. Admettons donc que tous les préfixes se comportent comme l'article - on le montrera par la suite - , en ce qu ' ils sont tous monosyllabiques (CV -); reste à déterminer la nature de cette voyelle, à la fois morphologiquement ex istante, et susceptible de modifier son timbre. Dans un premier temps, le phénomène de copie inciterait à poser des morphèmes à voyeUe libre, caractérisés par un archiphonème vocalique: on opposerait ainsi les deux articles wo-, pourvu d'un véritable phonème /0/, et nA-, dont la voyelle serait intrinsèquement trans parente, et de même les verbaux mA-, tA-, etc. Quelle serait donc l'origine phonétique de cet archiphonème? L'explication par coloration d 'une voyelle centrale [g] sous-jacente 7 (opposant désormais wo- à n~-) est mise en doute par l'absence totale de cette voye lle centrale en motlav, aussi bien au niveau phonétique que phonologique, si bien qu'une telle hypothèse serait ad hoc. Au lieu de spéculer sur des phonèmes inexistants, il est plus profitable d'examiner les faits plus précisément que ne l'ont fait les au teurs déjà cités, afin de déterminer les règles qui permettent d'attribuer un timbre à cette voyelle. Aussi voudrions-nous revenir sur les formes que J. Kasarhérou qualifie d 'exceptions, et dans lesquelles la copie ne semble pas se faire régulièrement. Outre la tortue déjà citée (na-o), de très nombreuses formes présentent des voyelles distinctes entre le préfixe et le lexème qui suit ; en outre, si l'on observe simultanément le comportement de deux préfixes dans des contextes lexicaux semblables, on constate de nombreuses irrégularités et incohérences par rapport à la règle de copie vocalique.

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV

447

Opposons ainsi l'art icle *nA- et le locatif *IA-: malgré un comportement apparemment similaire (nô-vôy, lô-vôy), ces deux préfixes présentent parfois deux voyelles distinctes, différant tan tôt entre elles, tantôt avec le lexème su ivant : ar/ide na-n aw na-slÎlal ~

~

tl.l8lt lJll.:Ylli!

traduction

loco/if

la mer la pluie

k:JIi!n

mOIl nom le "akamal le soleil l 'île, le village

l=iliII Ic-he-k

Ic-gmcl

U kol'lIJ!

Irad/ll:t;oll en mer sous la pluie en mon nom au lIakmllal au solei l en l'île, lm vi llage

Considérant comme régu liers les cas où la voyelle de l'article est semblable à celle du radical, comme dans na-nll\V ou ll:-gml:l, on cherche d'abord à rendre compte des formes «anonnales » (sou lignées) comme ll:-naw ou na -gmel, sans copie vocalique. C'est ainsi que Codri ngton explique, à tort, le a de na-b te par le même temle dans la langue voisine de mota, p{llal/: « lIable for 110 baIe» . De même, on pourra chercher à voir dans le a de na -gmel ou de na -,'nô, un vestige éventuel de la fomle étymologique (cf. le bislama lIakali/ai ou le mota "(lll//O), etc. Mais cette explication, justifiée pour les cas de transfel1 8, ne pennet pas de rendre compte de toutes ces >, cl d'emprunt s COlllllle Id-sto « l1lagas in ~ : lIucun ne peUl être rapporlé .11IX C:IS de transfert vocl.l lique comme ni·lwo < li wo, analysés en §2.3.

454

ALEXAN DRE FRANÇOIS

MOUVEM ENTS ET CLONAG ES DE VOYELL ES EN MOTLA V

455

2.2.5.1 Hypothèse diachronique

ture CCV- du lexème, et le bloquage quasi systémat ique de la copie

Un point de vue diachronique doit placer au centre de toute analyse morphologique du ma tI av le phénomène historique de l' accent ". Pour des raisons sans doute d ' origine accentuelle, comparables à l'évolution du latin au français, la structure des anciens polysyll abes présente en motlav, par rapport aux parlers voisins et aux états de langue historiques, une tendance neUe à la réduction du nombre des syllabes. Une syllabe ouverte accentuée a ainsi entraîné la chute de la voyelle posllol/ique lorsque celle-ci était en syllabe ouverte: c'est ce qui apparaît dans le nom même de notre île, qui de M6talâva est passé à Motlav [OmWotllap] , tandis qu'une autre île, nommée Ureparapara en 1110ta - langue voisine très con servatri ce et d'allure nettement polynésienne - , dev ient dans notre langue N-ôybaybay. Toutes les syllabes étant ouvertes au départ, on passe respecti vement de 4 ouvertes (cv) à 2 fermées (cvc), et de 6 ouve rtes à 3 fermées 16 Ces remarques nous penneUent de présenter notre hypothèse sur la causalité historique de la copie vocalique. Si l'on considère en effet que les morphèmes cOl1cemés (na, Ce) avaient initialement un statut

vocalique.

sinon d'affi xe, du moins de c1itique, il s ne devaient déjà former qu'une seule unité accentuelle avec le lexème auqu el ils se ratta -

chaient. en sorte que c'cst à l'unité syntaxique ccv-). C'est l'explicati on la plus vraisemblable de la corrélation entre struc15. Préc isons que cet foi ( 1), etc.

17. Ces «doublets» ont été reconnus camille tels p:lr l 'enquêteur, mais ne fonctionnent piiS en couple morphologique du point de vue des locuteurs: il n'y a là aucun procédé dérivatiollilei productif. 18. En réalité, tout se passe auj ourd'hui COlll llle si les fonnes possédées étai ent loutes accentuées sur la voyelle finale du rad ical, el cc, quel que soit le nombre des syllnbcs suivant es. 19. C'est le même phénomène qui a engendré, par exempl e. le joli couple toponymique Bourges < Bi/IÎ riges et Ben y < Bilul'Îgium: l' ajout d'une syll abe a dépl acé l'accent , et métnmorphosé l'étymon. 20. Il se trouve que ces cinq exemples dOllnent une voye lle ft pour le radical, rendant moins spcctaculaire la copie vocal ique (soulignée dans le tableau). Mai s on peut le vérilïer grâce aux critères d'identi ficat ion déjà exposés - ainsi, le préfi xe locati f lE· sc modifiera en la- dcvant balbe"", day. etc.

456

d'un radical commençant par CV-. Ces fa its reconstitués peuve nt être présentés dans le tableau ci-dessus21 . rae:. ss-jacellle

f sous-jacente >

factuelle

elltrée lexica le sens

· na balebé-ku *balcbe

· na balébe

na-balbe-k na-bJern (naml cm) na-ba lsc-k na-blas (namlasl

ba lbe"" °blem baIse""

joue

oblas lawhi .... °lwch

mâchoire neur de fleur

*Iawchi

· na · na · na "' na

*daye

·'HI daye

· ,'ayc

"' na l'ayé·ku "na ,'ayc

*balase

bâlasé-kll balase lawchi X lawéhi

"' na dayé-ku

na- Iawhi X na-Iweh

na-dJc-k lnanyekl °dyc'" nn-day d.y IHl-l'J'c-k rnapyekl ol'ye_ vay na-l'ay

plante de pied empreinte de pas

sang [a rch.] sang poitrine roie

a deux foi s la même consonne (1) , produisant une géminée Il ; comme toutes les géminées en motlav, le groupe s'est alors simplifié, et l'on obtient ' na-llo > na-Io, avec une consonne simple qui s'est morphologisée comme te lle, sans laisser de trace de l'ancien redoublement. L'absence de copi e vocalique, surprenante pour un mot de stru cture

apparente CV-, s'explique en réalité par la simplification d 'un ancien groupe de consonnes identiqu es. Il en est de même pour °he- «nom »: cette foi s-ci, on dispose d ' une forme non possédée du même mot (s ur le modèle des couples °dyc- / day), hah, et du parallèle avec le mota sasai, ce qui nous pe rmet de reconstituer une racine sous-jacente ' hahe (avec h < s). Les faits sont résumés dans le tableau ci-dessous, suivant le même raisonnement que pour °10-: l'OC.

ss·jac.

1 sOlls·jaceme

slmcl. ccv-

Notons d ' ailleurs que l 'opposition entre radicau x copiables (xxx) et

*'oto

bloquants (Oxxx) n'est pas liée directement à leur division morphologique, entre noms directement possédés (tawhi- , °dye-) et noms

· n ~ 1016 X >*na·1I0 *na 16Io(-w6no)

*hahe

*mi hahé·ku *na hahe

autonomes (Olweh, day): tandi s que les troi s premières raci nes don-

nent le trait [+copie] à leur fo rme possédée, les deux dernières inversent la situation. Le véri table critère est donc bel et bien phonologique: la copie ayant lieu lorsque l'accent frap pe la première syllabe du lexème originel. elle concerne. dans notre cas de figu re. les syn-

tagmes dont le nombre total de sy llabes est originellement impair (3 pour *na vayc, 5 dans le cas de *na ba lasé-ku) . Vo il à donc pOLir le cas général: la copie vocalique découle historiquement de la place de ,'accel/t . Bien sûr. la même ex pli cation ne perm et pas de rendre compte des excepti ons signalées plu s haut. N OLI S mentionnerons cependant une hypothèse pOlir élucider au

moins deux d 'entre elles, °he- «nom (de» > et

457

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLA V

ALEXANDRE FRANÇO IS

° l o~

«intérieur (de» >.

Ces deux radicau x CV -, qui paradoxalement ne permett ent pas la copi e vocaliqu e, peuven t en réalité être rapportés à une structure

CCV -, ou plus exactement à une anc ienne suite de syll abes CVCV-. Par exemple. °10_ provient d 'un ancien * 1010. attesté dans le mata

I%i et le mosina 1010-, ainsi que dans le préfi xe motlav 101- < *1610« for intéri eur, esprit » ; le syntagme (d irectemen t possessible) * IHI 1016-, a régulièrement donné, par la loi de syncope. * na- 1I0 , fo rm e parallèle aux radicaux CC V - type na-vnô. La différence es t ici qu 'on 2 1. Nous ne prétendons pas donner ici de véritables étymons tels que la grammaire historique peut les imaginer - ce qui al ourdirait ta présentation. du rail des changements consonantiques . cIe. II s' agit plutôt de «ronnes sOll s·jacentes», si t'on veut . Ill oycnll*na- hhe-k na· he·k na-hah

°hehah

intérieur (tristesse) nom (de) nom

Il est probable que d ' autres exceptions puissent s'expliquer par des rai sonnement s analogues, que nous ne développerons pas ici.

2.2.5.2 Nécessité théorique d'une autre analyse Nous venon s de défin ir les cau ses historiques de la copie voca-

lique, de façon à rendre compte de la complex ité des faits actuels du motlav . Il se pose désormais une question d 'ordre épistémolog ique: l'exp lication diac hron ique est-elle suffisante? Permet-elle à elle seule de présenter le fonctionnement réel de la langue, te l que les locuteurs le me ttent réellement en œuvre? E il d'autres termes, il faut savoir distinguer les causes historiques des phénomènes, telles que le linguiste peut les reconstituer, et les opérations cognitives qui fOll t système ell synchronie : ce sont ces opérations-là qui sont réellement mi ses en j eu par les locuteurs eux-mêmes, leur permett ant de calculer à chaque

instant les formes requises par leurs choix d 'ex pression. L'e njeu d'une telle distinction est fonda mental pour la théorie linguistiqu e: car si les deux démarches - diachron ie / synchronie sont en elles-mêmes autan t légit imes pour l 'observat eur des langues, elles correspondent à deux altitudes sc ientifiques fondamentalement oppo sées. L'explication diachrollique , pour sa tisfaisante qu'elle soit pour l 'espri t, tend à représenter la co mp lex ité des règles grammaticales observées comme résultant d 'une évolution mécanique à partir

458

459

ALEXANDRE FRANÇOIS

MOUVEM ENTS ET CLONAG ES DE VOYELLES EN MOTLAV

de systèmes plus anciens, fondamentalement conçus comme simples et réguliers. Les règles actuelles seront gé néralement décrites comme des règles arb itraires et opaques, mémorisées individuellement, pour chaque sous-classe du lexique, ou même chaque lexème séparément; on grossira, par conséquent, les données stockées dans le lexique, au détriment des règles morpho(phono)logiques qui permeuent de traiter un nombre infini de données. En sorte qu 'on auribuera au locuteur la fonction toute passive d 'appliquer des règles désormais immolivées, sans autre liberté que celle de faire des fautes. Inversement, l'analyse synchroniql/e des faits de langue adopte le point de vue, sinon le parti, du locuteur en tant que sujet d'énonciation. Les formes ne sont pas seulement répétées telles qu'elles ont été

munication - particulièrement celles des noms - , qui explique le maintien des formes irrégulières dans la langue; l'autre partie des formes est produite dans le moment même de l'énonciation, en vertu de règles systématiques dégagées par le sujet lui-même, à partir des régulari tés observées dans la langue telle qu'il l'a apprise".

appri ses, mai s sont produites au moment même de l 'énonciation, au

moyen de procédés morphologiques productifs: ces fonnes ne sont plus conçues comme des vestiges arbitraires d'un état de langue ancien, mais le résultat toujours motivé d 'opérations universelles, portant à chaque foi s sur un nombre minimal d'éléments combinables entre eux.

Qu'en est-il des règles de la copie vocalique? Là comme ailleurs, on peut parier qu'cl les ne seront pas comprises sans faire appel aux

deux points de vue entremêlés. Le tout-diachronique ne pennet pas d'exp liquer comment les locuteurs parviennent à calculer les formes correctes pOUf des mots entièrement nouveaux: les fonnes °na-qlismen «policier» (CCV- > pas de copie) et no-dokta copie) n'ont pas de profondeur historique, et sont donc nécessairement calculées à partir de règles de transformations synchroniques. Inversement, c'cst ulle erreur des systèmes formels -

gram-

maire générati ve, théorie culiolienne - que de pri vilégier les moyens mécaniques dans la production du discours, en négligeant délibérément la pression sociale de l' usage et des formes figées : car de telles théories sont à leur tour gênées pour intégrer dans leur système explicatif les formes irrégulières comme na-lêt (CV- mais pas de copie) ou ni-qti- (CCV-mais copie). En réalité, le défaut de ces deux points de vue, pourtant si opposés, est le même: on néglige à chaque foi s les conditions réelles d'apprentissage et d ' usage de la langue par les locute urs. C'est bien là, selon nous, l' apport majeur que doit représenter l' ap proche fonctionIlnliste du langage, que de toujours expliquer les phénom ènes linguistiques par les conditions concrètes de leur production chez les locuteurs capacités cogniti ves, mode d'acquisition, ctc. Or, ces conditions sont précisément ambivalentes: une panie des form es est

apprise telle que lle, sous la pression du groupe, lors de l'apprclllissage de la langue. et c'es t souvent Icur haute rréquence dans la com-

2.2.6 Synchronie: pour une représentation multi-linéaire 2.2.6. 1 Propagation et bloquage Par conséquent, concernant le phénomène de copie vocalique en motlav, on est fondé à considérer l'explication diachro nique que nous avons fournie ci-dessus, comme incomplète. Il resterait à définir les opérati ons mentales véritablement à l'œuvre dans la production des formes correctes, sans se référer à un accent tonique qui , malgré une grande force explicative pour le diachronicien, a aujourd'h ui disparu comme tel du motlav. De même, les é tymons ou racines sous-jacentes, imprudemment reconstitués pour quelques lexèmes, n' ont aucune réalité morphologique dans la langue actuelle: il est donc exclu de leur donner une quelconque valeur dans l'analyse synchronique des faits. Cette interprétation de la copie vocalique, qui raisonnait sur d'anciennes syllabes CV- en nombre différent (*na dayé-ku 1 *na daye), va désormais porter sur des formes où le nombre de syllabes sera éventuellement identique, mais leur structure distincte (Ona-dlye.k, na-Iday), etc. II faut donc tout reprendre au début, e t partir des form es attestées, en laissan t de côté l'étymologie. Essayons de formuler la règle de la copie vocalique, sans plus la faire dépendre d'un accent désormais inexistant. Du point de vue du préfixe lui-même, on dira par exemple que la voyelle d'I/II préfixe adopte le timbre de la voyelle sl/imllle. si elle se trOl/ve elle-même ell syllabe ol/verte (nô-Ivôy); inversement, la voyelle d'lIl1 préfixe est cOllservée telle qI/elle Cil syllabe fermée (O na-vlnô). Nous ne développerons pas cette formulation , qui pourrait cependant être choisie par telle ou telle approche théorique privilégiant l'opposition [syllabe ol/verte vs. fermée]. Une au tre représentation est possible, en partant de la forme du rad ical lui -même. Tout se passe comme si 1111 groupe illititll de deux consonnes faisait barrage à la propagation vers la gauche du timbre de sa première voyelle (schéma CCV-l, tandis qU'l/lle seille COllsolllle y serait perméable (CV-). Si elle sat isfait l' intuition, cette nouvelle 22. Pour celte dernière idée. voi r 1l01,U1Unelll le premier clmpilre de L.1 ngackcr (1987).

460

46 1

ALEXAN DRE FRANÇOIS

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV

définition mérite e ncore d 'être précisée, et nous le ferons à l'aide des notions développées par la phonologie autosegmentaJe. C'est ainsi que Nick Clements ( 1993: 132) décèle dans certains mots du kolami (langue dravidienne) tels que killik, sl/l/Il/p , lIIelep, ayak, une «règle de propagation de nœuds vocaliques». Pour ce faire, il reprend la proposition que fait McCarthy (1989: 74) de disposer voyelles et consonnes sur deux plans différents - ce qu'il appelle plallar VIC segregalioll -, pour rendre compte de faits de langue sémitiques et amérindiennes. Yoici le résumé qu 'en donne Clements (1993: 133) :

Le cas de ce laI n'est pas sans rappeler celui des phollèmes j7oltallls, définis par la même théorie autosegmentale. Ainsi, Encrevé

Lorsque le gabarit sq uelett al est in trod uit au cou rs de la déri vation, les consonnes s' attachent à ce gabarit sur une fami lle de plans et les voye ll es s'attachent sur une autre, sa ns qu ' il y ail d 'intersecti on. A ce point, consonnes ct voyelles sont enti èrement séparées dans les représentati ons et sont réunies au tenne du process us ultérieur de fusion des pl ans (rier cOllflatioll).

Sans entrer ici dans les détails de sa théorie, on peut envisager une représentation similai re pour la copie vocalique en motlav. Pour ex pliquer une forme comme nô·vôy « le volcan», on parlera d' une propagatiol/ vocalique vers la ga uche, du lexème vers le préfixe, chaque foi s que ces derniers ne sont séparés que par une seule consonne. Inversement, dans une form e sans copie comme °na-ghôw «le rat», on est obligé de constater que la propagation ne s'est pas faite , autrement dit qu'un groupe de deu x consonnes, en motlav, constitue - sauf exception - ce que C lements appellerait un «nœud barrière » pour cette propagation. C VI C V C Il

.r

V

+

~'-- --- ô

C V C maÎs

Il

g

C V C h

( 1988) rend compte de la liaison en français par la notion de consonne fl ottante, signifiant qu'elle «peut ou non appa raître phonétiq uement selon les contextes, son apparition étant liée à une possible association au sque lette »". Par exemple, on dit «mon peti(t) frère » sans liaison, mais «mon petit/\ ami» avec liaison, car la place pour une consonne cst laissée vide au début du mot sui va nt , au torisant la prononciation du [1] de liaison. De même, en tonologic, A. Rialland fait régulièrement appel à la notion de louj7ollalll. De façon parallèle, une voyelle fiaI/aille sera susceptible de se réaliser ou non, en fonc tion de règles phonologiques propres à la langue considérée - ic i, le motlav: e lle n'apparaîtra dans '111 mol que si la place est libre, autrement dit si une position vocal ique est laissée vacante par les au tres phonèmes en présence. On peut ai nsi distinguer trois cas de figure pour rep résenter l'absence ou la présence de copie voca lique. • La place est pl'Îsc l,ar une voyelle plcine Contrairement à la voyelle d'un préfixe inva riable, YI' (a dans le cas de l'article) s'élide lorsque le mot sui vant commence lui-même par tlne voyelle - ce que nous pouvons maintenant reformuler ainsi: un phonème nottant n'apparaît pas lorsque la place est déjà prise dans le squelette sy llabique. Prenons le nom ulsi- «cime»: la position Y étant assumée par l' initiale du lexème, il n 'y a plus lie u d 'y inscrire le a de l'article, qui reste virtue l" .

c v ccvc

w

nu

+ + a U . --- ô

s

i

A

2.2.6.2 Les préfixes copiants: une voyelle nottante Ces schémas mé ritent qu 'on s'y attardent , pour les questions théoriques qu ' ils soulèvent. La princ ipale question concern e la voyelle du pré fi xe, en l'occurrence lai: comment ex pliquer son apparition dans le second schéma, si elle était absente du premier? Comment représenter un phonème qu i tan tôt se réali se (co mme dans °nn· ghôw), tantôt reste en plan (da ns nQ-vôy)? Doit-on le considérer totalement présent dans le premie r cas, et totalement absen t dans le second , ou bien peut-on lui attribuer un statut intermédiaire dans la théorie, combinable à tous les lexèmes?

On pourra it cependant se demander pourquoi on ne peut pas avoir . na-ulsi, avec dellx voyelles adjacen tes. La réponse tient dans lIne des c IIf-mflle- avec !,opie) à mEnay (> II f -mllay par transfert), et on choisira de noter kEle-, IÊwo-, hInag, etc. Comment caractériser les lexèmes à transfert, par rapport aux deux catégories principales que nous avions définies pour la copie? Avant toute spéculation di ac hronique, deux points de vue sont a pr;ori possibles: si l' on est dans la configuration accentuelle des lexèmes copiables de type CV(CV)-, alors l'altération (copie) du préfixe est nonnale, et c 'es t la chute de la voyelle radicale qui surprend, puisque

revanche, il conceme une sOlls-c1asse assez restreinte de lexèmes une quinzaine au maximum - , qui ne peuvent être classés dans aucune des catégories établies ci-dessus pour prése nter la copie vocalique: ni lexèmes bloquants ni précisément copiables, ni CV- ni CCV-, ils ti ennent de chacune de ces classes, et méritent en réalité un traitement à part. 2.3.1 De la résistance de quelques voyelles fermées Alors que la copie proprement dite consistait, pour un préfixe, à adopter le timbre d'une voyelle voisine en présence de cette derni ère, le trallsfert implique également un chan ge ment de timbre dan s le préfixe, mais s 'accompagne de la chute de la voye lle radicale ainsi copiée. Par exemple, le nom de l'igname hinag, précédé de l'articl e nA-, devient ni-hnag: le i du radical se copie sur la voyelle du préfixe avant de disparaître, soit nA- + hinag > *ni-hinag > ni-hnag. On peut également présenter la chose en disant que le i a directeme nt migré d ' une position à "autre, sans passer par le stade intennédiaj re de la copie; la distinction peut avoir son importance, dans la mesure où on introduit la notion de mouvement pour un phonème entier, el non plus de copie d ' un timbre vocalique d'une voyelle à une autre. La question reste à élucider. Quoi qu ' il en soit, on a toujours la transformation sui vante: (c.v.- + c,V,c,v,- > C.VrC ,C,V,- ). Avant d 'aller plus avant dans la théorisation, nous po uvons étoffer le corpu s des exemples. Le radical nu (sans préfixe)" donné dans le tableau existe toujours par ailleurs dans la langue, sous cette forme ce qui n' est pas le cas, on le verra, des radicau x commençant théoriquement par CCV-. lexème

1111

préfixe

kê lc....

liA ·

dêlo'"

liA IIA -

lêwo.... ""étibêhtg

bêhay hinug

vêhog

IIA IIA IIA IIAIIA -

lexème préfixé nê-kle'" né·dlo.... nê-Iwo ....

nê-wli-

sens dos cou dent branche

nê-blag

poule sauvage

nê-bhay

(poisson)

ni-hnag

igname

nê-vhog

liwo

IIE-, "A·

ni-Iwo

mênay

IIE-, IIA-

nê-mnay

chair grand (-cur) intelligent (-ce)

liwag

IIE-

vi-twag

num . un

25. Nous l'étudierons sous le nom de FA « forme autonome» plu s loin, en §2.4. 1.

26. Comme pour les archiphonèmes ou notre notation des préfixes à voyelle copi ante, la majuscule suggère toujours que le phonème est intrinsèq uement alt érab le, contrairement aux minuscul es qui désignent normalement des phonèmes à part entière. On donnera bierytôl une assise théoriq ue à notre convention de la maju scul e: cf. note 3 1.

466

467

ALEXANDRE FRANÇOIS

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV

dans ce cas-là elle est originellement accentuée - au lieu de nêIwo.... , on devrait avoir *Ilê-lêwo-. Si en revanche le transfert vocalique est un cas particulier des lexèmes en CCV -, alors la chute de la voyelle n'a rien pour étonner, et c'est plutô t son maintien sous forme de transfert qui est remarquable - face à nê-Iwo-, la form e attendue serait *Ila-Iwo ..... L'examen des lexèmes concernés désignent la deuxième possibilité comme étant la bonne : dans un schéma où la syncope d'origine accentuelle engendre normalement des radicaux CCV- sans possibilité de copie sur le préfixe (110-, le-, me-.. .), les cas de transfert vocalique se disting uent non par leur structure syllabique, mais par l'altération qu ' il font subir à ce préfi xe, pourtant sous l'accent. Mais alors, étant donné une racine C , v ,c,v , - syncopée normalement - par effet de l'accent en C,C,V,-, dans quel cas y aura-t-il trallsfert (V , se retrouve sur le préfixe), bloqlloge (V, disparaît complètement, sans laisser de trace dans la langue, et le préfixe Cov o- reste in variable), ou copie (V, disparaît, et c'est V, qui est copiée sur l'article)? La situation est compliquée: nous allons tenter de l'exposer dans un tableau. Celui-ci réunit la plupart des cas rencontrés au cours de cette étude, afin de pouvoir les comparer et proposer une synthèse des règles liées à la copie vocalique".

Inutile de revenir sur les exemples de copie et de bloquage vocaliques, déjà lo nguement expliqués; rappelons simplement que les lignes 3, 8 et 10 sont des cas normaux de copie: l'accent frappant originellement la première voyelle du lexème (V, ), maintient le radical C, V,-, mais entraîne l'assimilation du préfixe prétonique (v o > V,). Inversement, lorsque l'accent était décalé d'un cran comme en 1 et 2, V, devenue posttonique disparaissait complètement de la lang ue, tandis que v o restai t intacte: la copie est bloquée dans le schéma C ,C,V,-. En face de 3 qu'on vient de relever, la même racine lêwo donne lieu, à la ligne 4, à un transfert vocaliq ue, là où l'on attendai t un s imple bloquage. On retrouve le même phénomène de transfert en 5 et 6: au lieu de disparaître, le timbre de V, se retrouve sur le préfixe. Afin de rendre compte de la différence de traitement entre les racines 1-2 et 3-5-6, il semble qu'il faille prend re au sérieux une observation que nous avons faite au passage: le transfert vocalique porte exclusivement sur les racines où V, est une voyelle antérieure fermée, à savoir i ou ê (I/ ?). Tandis qu' avec toute autre voyelle (e, 0, 0, ô .. .), v o accentuée restait telle que lle (0 pour l' article, e pour les autres préfi xes) sans jamais s'assimiler, les deux voyelles les pl us antérieures étaient assez ni-hnag. Voilà qui permettrait d'éliminer encore tout un paquet d'exceptions, rendant quasiment absolue la règle du bloquage de la copie par les radicaux CCV-. A cette occasion, pour plus de cohérence, il faudrait rebaptiser les entrées lex icales sur le modèle hlnag, et remplacer donc les radicaux type hyi- en hlyi-, vni- en vlni-, qti- en qIti-, etc. Pour être rigoureuse, cette solution séduisante doit cependant être pondérée par quelques remarques. La vraisemblance de notre analyse pour hlyi- est confirmée par le doublet hiy, qui révèle la nature de V" On pourrait objecter qu'à la troisième personne (ligne 7b), l'article nô- reflète une altération de V2 [ê] et non de VI ri ], preuve qu 'il s'agirait d'une copie à distance; en réalité, ce phénomène a été traité au §2. l. sur l'harmonie vocalique, et Il 'a rien à voir avec la copie ou le transfert de voyelles. Un argument plus sérieux concerne les lexèmes dont on ne peut pas reconstruire une voye lle

V I;::;;

i, comme

en 9 et 10. Le nom qfii- signifie, en parlant d' une église, le « jour de la fête paroissiale» , et désigne, avec un possesseur humai n, une pierre

magique investie du souffle d 'une personne, censée représenter la durée de sa vic; ni-qfii-k « ma pierre » tombera de la niche sacrée le

jour de ma mort, plus précisément elle est -

par métonymie «mon jour, mon destin»: aussi ne fait-il nul doute qu ' il fa ille rapporter ce terme au nom désignant le jour / la nuit, qôfi < * qôlîi (cf. 10). Si cette hypothèse est juste, alors on doit admettre que le timbre i de l' article provient non pas d'un transfert de V, (on aurait alors * I/Ôqfli-k, et sinon, par bloquage, * I/a-qlîi-k), mais hel et bi en de V2, la voyelle tonique29 • En sorte qu 'il faudrait renoncer à l'explication proposée ci-dessus pour rendre compte des cas exceptiol/llels de copie vocalique sur des lexèmes CCV-. De toute façon, on fera remarquer que l'analyse porte sur un très petit nombre de lexèmes (une demidouzaine), et qui plus est sur des exceptions, en sorte que la fiabilité de l'analyse devient douteuse: il est vraisemblable que du point de vue du locuteur, ces lexèmes déviants sont appris tels quels, sans qu'il faille supposer la mise en œuvre d'opérations et de règles plus complexes. 29. Ce même rai sonnement pourra it être mené pou r d'autres contre-exemples, ni· mdi'" < . na madi ' ncz·. nê-tqê < · ua luqê 'jardin' , ni·qti .... < · tla qêti 'tête', el inversement n,ê-wli- < wêli 'branche'. sans parler d'aut res incertit udes: ni-qil i- est

·"a

souvent réali sé nê-qni-, ctc.

469

Quoi qu ' il en soit de cet exemple, on consentira à doter de toute façon les voyelles fermées i et ê - peut-être Il - de propriétés morphophonologiques particulières en motlav. On peut presque parler d'une forme de «résistance» de ces voyelles d'aperture minimale, qui semblent souvent subsister dans des cas de figure où les autres voyelles disparaissent corps et biens, comme ici en position posttonique. 2.4 L'il/sertioll vocalique

Après nous être aventurés dans les recoins les plus obscurs de la morpho-phonologie du motlav, nous allons exposer un phénomène particulièrement répandu dans la langue, et comme on le verra, assez simple : il s'agit de l'insertion d'une voyelle de soutien dans un lexème CCV-non préfixé. Comme on le voit, on quitte désonnais l'arsenal de morphèmes sur lesquels jouaient les faits de copie et transfert vocaliques - article nA-, statif nE-, etc. - , pour nous intéresser au cas où ils sont précisément absents: comment se présente alors le lexème nu? Si ce cas est présenté ici après celui des mots munis de leurs préfixes, c'est que certains arguments suggèrent la primauté morphologiq ue d'un syntagme comme na-vnô sur une forme simple comme vônô. Nous ne nous attarderons pas sur les diverses conditions syntaxiques qui font apparaître noms, verbes, etc. sans leur préfixe: noms déterminant un autre nom, verbes à l'inaccompli (sauf 350), adjectifs en fonction d'épithètes, numéraux employés comme distributifs ... L'essentiel est de savoir que la quasi-totalité du lexique est susceptible d'apparaître, même rarement, sans aucun préfixe. Ce cas de figure n'est pas sans conséquences pour l'analyse phonologique du motlav . 2-4.1 Forme prélixa ble, forme autonome Si on laisse de côté les questions de suffixation, chaque lexème ne peut apparaître que sous deux fOlllles allomorph iques: forme alltoI/ome (FA) et forme préfixable (FP). Nous avons largement côtoyé cette dernière dans les paragraphes précédents: pour obtenir une forme préfixable, il suffit d'opérer une soustraction à partir d'un syntagme à préfixe. Par exemple, la FP dans n-ôlÛ est Ôtil , celle de nôvôy est vôy, celle de na-vnô est -vnô, celle de ni-hnllg est -llIIag; on verra pourquoi c'est cette forme , à peu de choses près, que l'on choisira pour chaque en trée lexicale. Or, ces mêmes lexèmes apparaissent légèrement modifiés lorsqu' ils sont seuls (FA). Si ôtil et vôy (V- et

471

A LEXANDRE FRANÇOIS

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV

CV-) peuvent apparaître tels quels en position de mots autonomes, ce n'est pas le cas des deux aut res, dont la FP présente deux consonnes initiales (CCV-): en position de FA, ces unités auront respecti vement les formes vônô et hinag. En effet, en ve rtu des règles d'organisation syllabique du J!!.Ql, on sait que de telles formes CCV,- (vnô, Imag) ne peuvent apparaître telles quelles, même précédées de particules proclitiques ou d'autres mots dans la chaîne parlée 30 : on a obligatoirement une séquence CV;CV-, pourvue d ' une voyelle supplémentaire V;, identique ou non à la voyelle V, du lexème. C'est cette voyelle supplémenta ire qui nous intéresse: comment son timbre est-i l déterminé? Quelle est sa nature phonologique? S'agit-il d'un vestige d' une voyelle étymologique avant syncope, ou au contra ire du résultat d'une nouvelle opération sur le radical CCV-? En d'autres termes , doit-on poser FP (ex. vnô) comme construite - par soustraction d'une voyelle - à partir de FA (vônô), ou inversement FA dérivée de FP - par insertion vocalique?

préfixe C(V)- élidé ressemblent fort aux mots à transfert: ainsi êglal «cOImaÎtre» donne au statif nêglal. forme que l'on pourrait croire construite à parti r d'un ··gÊlal par transfert vocalique. De même, il a été difficile, même à mes informateurs, de décider si la FA de nêvhog «chair, viande» est êvhog ou vêhog, les deux donnant effect ivement, en théorie, le même résultat. On ne peut donc pas toujours calcu ler FA à partir d'une forme à préfixe. En réalité, nous avions déjà établ i qu'inversement, à partir d'une FA mênay on ne pouvait pas prédire à coup sOr un transfert vocalique en nê-mnay, puisqu'il ex iste des lexèmes où une structure similaire (C, ['l,le, V - ) reste intacte en cas de préfixation, donnant lieu à une simple copie, comme mêne~ > n ê-m ê ne~. Par conséquent, on doit conclure qu 'aucune règle ne permet de dériver FA de la forme préfixée (car nêvhog > F.A. êvhog 011 vêhog?), ni l'inverse (F.A. mêne~ > nê-m ê n e~ 011 * nê -mne~?). On est donc condui t à poser une entrée lexicale dotée d ' une voyelle mobi le notée par la majuscule, comme nous l'avions présentée provisoirement dans le paragraphe précédent:

470

lexème préfixé

FP

FA

sens

propriétés prlfixe

n-êm nô-vôy

êm

êm

ÉLISION

lexème prlfixé

FA

el/trée lex.

sellS

vôy

vôy ' vônô hinag

maison volcan

COPIE

ni.mfne....

mène'"

cerveau

COPIE

île ig name

BLOQUAGE

nf mnay niglal ntvhog

mênay êglal

mène.... m Ênay

intelligence

TRANSFERT

connaître c hair

~Ll S t ON ail

na-vnô ni-hnag

VII Ô

Imag

TRANSFERT

êvhog? vêhog?

êglal

êvhog? vÊhog?

propriétés préJixe

~].I SION

TRANSFERT?

2.4.2 Les lexèmes à voyelle flottante Concernant les lexèmes du type hinag « igname» , caractérisés, pour la préfixation, par le Irallsferl vocalique, l'origine de la voyelle V; (en l'occurrence IiI) ne fait pas mystère: elle a toujours le même tim bre que la voyelle du préfixe. Vraisemblablement, FA hinag est antérieure à FP ni-hnag, du moins dans la mesure où elle reflète directement la séquence étymologique CVCV-: ce lexème remonte à une racine ·sinaga «nourriture, ell partie. légume», dont la FA hinag déri ve directement, tandis que la FP ni-hnag suppose la mise en œuvre d'une opération supplémentaire de transfert vocalique sur l'article. La preuve que l'on ne peut pas dériver la FA (hinag) de la forme préfixée, c'est qu'il existe des lexèmes VCCV-, qui dotés d ' un 30. Nous avons précisément retenu celte marque intégrative (Lemaréchal 1989) pour distinguer, en motlav, les préfixes des proclitiques, qui sont suivis respectivemCIlI des FP et des FA. Tandis qu ' un préfixe cv- peut s 'accoler à la forme CCV - du lexème pour constituer un seul cclllot» (article na- dans na-vnô), on reconnaît un proclitique - même de structu re cv - à ce qu' il ex ige la FA du lexème, comme le relateur ne dans ne vônô 'de J' île '.

Quelle description donner à cette voyelle mobile, après l'exposé de toutes ses propriétés? Encore une fois, on est tenté de la rapprocher de la notion de phonème flol/olII, déjà développée à propos des préfixes copiants 3t . Cependant, il faudrai t ici en défi nir un nouveau type, doté d'une propriété particulière: en effet, alors que le phonème flottant «classique» a pour seul choix de se réaliser ou non dans une position donnée, celu i que nous étudions ici serait en outre susceptible de s'associer à deux places différentes dans le mot, en fonction du contexte. Alors que les ê de m ê ne~ ou êglal sont des phonèmes de plein statut, intrinsèquement associés à une position fixe dans la séquence phonématique, celu i de mÊ nay - comme le i de hlnag - est susceptible de s'associer dive rsement dans le mot, selon le schéma syllabique de celui-ci: 3 1. Cr. §2.2.6.2. Voilà qui rend cohéreme, a posferiori, la convent ion de la majuscule .

472

J. avant la première conSOllne CI en cas de préfixation par un morphème C V· à

473

MOUVEMENTS ET CLONAGES DE VOYELLES EN MOTLAV

ALEXANDR E FR ANÇOIS

voyelle copiante;

2. après CI lorsque le 1110 1 est autonome (FA), ou bi en préfi xé par un morphème CVC- (ex. mal ACCOMPLI); 3. II/Ille part si le pré fi xe est llll CV- in variable (ex. ni- INACP;3SG).

On a par exemple, pour le lexème mÊnay « intelligence / (être) intelligent » : préfixe

lexème préfixé

sens

VF& C,

nA·! nE·

intelligence / -ent

avunt

mal-

nimnay malm..ê:nay

0

~nay

il est déjà intelligent être intelligent

après

ni-

nilllnay

il dev ient intelligent

non

.. près

Comme on l' a vu pour la voyelle préfixale, le trait [+flottant] impose d'abord une alternati ve entre réalisation / non-réalisation du phonème. Mais ce qu ' il y a de nOLlveau ici, pOLIr la théorie phonolo· gique, c'est que la réal isal ion de cette voyelle flottante l'autorise à occ uper deux positions différentes, à gauche 0 1/ à droite de la consonne CI du lexème. Ce phénomène, plus encore que celui de la copie vocalique, confirme la pertinence de distinguer les deux plans des voyelles et des consonnes, comme le propose McCarthy ( 1989: 74). En ce qui nous concerne, on peut dire que les consonnes sonl les premières ratlac hées au «gabarit squeletta!» CVCICVC, suivies des voyelles pleines - phonèmes à part entière, intrinsèquement associés à une position dans le squelette. Une foi s constitué, ce squelette lai sse parfois des cases vides, qui soil peuvent le rester (cas des Cl, soit doivent obligatoirement être instanciées (cas des positions V). C'est alors, et seulement à ce moment-là, que les voyelles fiaI/aI/tes pOl/rrollt prétel/dre s'il/sérer dans le II/ot, si et seu lemen t si les structures phonologiques ont créées des positions vides qu'elles peuvent remplir.

Comme on le voit, toutes les positions du squelette sont occupées par les phonèmes fi xes de nos deux morphèmes: en particulier, comme la fomle du préfixe CV· permet au III initial de s'y rattacher pour clore la syllabe, il ne reste plus de place libre pour la voyelle flottante ê. Celle·ci ne peut donc se réaliser nulle part dans la séquence. Cec i étant dit, comment justifier l' impossibilité de ' ni-mênay? Il est peut-être nécessaire de poser une contrainte supplémentai re de type: «On ne doit pas avoir la suite *cv-cvcvc» (cf. la syncope historique), ou encore ( voyell e du préfixe (§2.4.2), pui sque le lAI de l'arti cle aurait supplanté le lEI fl ouant du lexème.

justifie nos conventions de notations pour l'établissement d'un dictionnaire.

La preuve qu 'i l est ainsi possible de poser de te lles règles indépendamment des structures étymologiques des lexèmes, c'est que l' insertion vocalique fonctionn e même lorsque l'é tymon est de forme CCV-: ainsi, l'anglais plate «assiette», par l' intermédiaire du pidgin pleil, a été anciennement emprunté sous la forme nê-blêit [llImllliit] avec l' article, ce qui donne, si l'on ôte le préfixe, b~lêit [mb,lhlit] par insertion de la première voyelle du radical. En synchronie, on n'a plus besoin de poser une voyelle déjà ex istante, puis une assimilation de timbre avec la voyelle suivante; il est bien plus satisfaisant de considérer que ce sont les structures syllabiques contrai36. Voir cependant note 38.

478

479

ALEXANDRE FRANÇOIS

MOU VEMENTS ET CLONAGES DE VOY ELLES EN MOTLA V

gnantes qui créent des positions vides, lesquelles seront éventuellement remplies par des clones d 'autres voyelles. Nous pouvons illustrer la règle, encore une fois , en tennes de phonologie multilinéaire, avec l'exemple de la « pomme » . Au lieu de partir d ' un radical gêvêg s 'abrégeant en cas de syncope, on pose carrément une seule voyelle morphologique pour ce lexème, qui dans le dictionnaire figurera gvêg. Celle voyelle n'apparaît normalement qu'une foi s, lorsque la structure syllabique du mot le permet, c'est à dire lorsque la première consonne du radical peUl fermer une sy llabe précédente - ainsi, avec l'article nA- , °gvêg donne directemelll la fonn e na-gvêg, sans passer par 'na-gêvêg puis une syncope. En revanche, lorsque le radical doit se répartir sur deux syllabes - faute de voyelle préfixale - , en l' absence d'autre prétendant (comme la voyelle flollante Ê de mÊnay), la voyelle radicale se duplique automatiquement pour venir remplir la position de voyelle engendrée par la structure syllabique: °gvêg > ~vêg par insertion de ê.

mologie, puisqu'on pourra toujours calculer la bonne fom,e à l'aide de la règle simple d ' insertion. Ainsi, le substantif non pré fixabl e wulus « beau-frère», quoiqu'invariable, corres pondrait morphologiquement à ·wlus - comme le révèle le dérivé (par dérivation zéro) na-wlus ; a-Igiy «après, derrière » se rerrouve dans le composé wotwot-ligiy « puîné, li/l . né-après» ; l' indéfini ya-Ikel «quelques X, cenains X » est corrélé à l'adverbe t~kel lIi-llI/ag), mw ther phollolog ical /"Ille of Ihe .mme lallguage. Last but 1lOlleasl, rhe /"Illefor " syl/abic epelllhesis" (e.g. IIIlig > mi lig) is Ihe key 10 the IV/IOle system, lhrough wll ich certain so-cal/ed morphological cat10

BI -TI V GATGAT To- M oTLAV,

SO AMAG

KËV

Hm lOLE QELE AVE , BA NÊ-DÊMDÊM NAN VATKELGI NA-HAV . -Na-IIIYôs

ANGOUJARD, Jean-Pierre, 1997: Théorie de ta syllabe, coll. Sciences du Langage,

egories prove

HOHOLE GÔfI

485

be el11irely derivable t ram pl/Ol1%g ical paltems.

lIIillO, sa 1I0k sa kaka lolllleyell bi-riy garga r ro-M orlav sa qele ove, rô 110 ra -)'av go)' lI i-diksolleri lIIey lIê-wê. Codr illgroll kê 1110 1 kaka re mI/Il rô aê, ba er qêr qere, rogoy "ip se. E II rô gôs kê, lIê-vêvê"i)' lIIillO qele gêll , sa: 11O-IIO" ole deI 1I0-1I0-lIgêll , wô ba-" m' lIa -qrêqrêg 11011 lIe- regregllCl ge" ? Qe sa, gên ôl sa «lIok vall IOr lIa- lêr» (riwag lIIi «110»), ba rô «110 lIIe-gell rô lIê- lêl » (Iiwag lIIi «lIê»). A sa, yalkel " o" ole SI/SI/ (qele «110 » ell ), )'alkelgi gêll sa ôl ell , lIô-lôlê-1I lIi-leg" a dell 1I0-" 0" 0Ie lIIey vi/Wag 11011 (lIa -lêt, si sa OO-VII Ô, oo-gmel , lia -la), ba ya lkelgi se, gêll yOIÎ leg sa IlCIylêyê" êwê qele 1I0-" 0" 0Ie Ille)' algiy (Ilf.- Iêl , /lÛ.-vôy, ill-sil, lliI.-gellgell ). Ba 1I0-" 0" 0Ie SI/SI/ liOn, gêll sa vav sa lIi-liy kê mey ove? «JW » si sa «Ilê» ? Ne-mell a Ile-me". Tô Ilok dêlll lok sa ige la-M oI kêy vav 110-1/111-)' qele ove, ige del la-Ballkis kê)' vav na-mu-y qete ove geh. tô Ilok dêm sas ê-gêll : sa llO-hO/IOle noIIgêllllla-vall Ille ove , ba ige bôbô 1I0-ngên mÎwg kê)' IIO" ole qele ove. A sa: yav ba" IlIIligl en, ba gên lê-dêlll sas lowoyig vê" sa 110-" 0-11 vitwag «Jw-mlig », ba Ila- IW-Il vi/wag «nô-Iôt; 11Ii lig». Tô 110 ta-galeg vê" nô-/Jôk Ille)' " aylêyê" galsi lIIi IIi-Ii)' galgal llo-ngên.

Alexandre FRANÇOIS

Bulletin de la Société de Linguistique de Paris, t.XCV (2000), fasc.1 p.15-42. Paris: Klincksieck.

DÉRIVATION LEXICALE ET VARIATIONS D'ACTANCE : PETITS ARRANGEMENTS AVEC LA SYNTAXE

RÉSUMÉ – La description de langues inconnues suggère à la linguistique générale certains principes méthodologiques, tels que la prise en compte de l'énoncé contextualisé comme unité primordiale de l'observation du sens. Cette méthode rigoureuse prouve sa force en permettant de reconstituer la signification et le fonctionnement, en motlav (Océanie), d'un suffixe fortement polysémique. Rappelant à la fois les questions de préverbation dans les langues européennes, mais aussi les séries verbales ou les morphèmes applicatifs de plusieurs régions du monde, ce suffixe verbal goy nous permet d'explorer, d'une part, le domaine de la sémantique lexicale, et d'autre part, les questions syntaxiques de valence et de transitivité. Nous définissons ce morphème goy par un "scénario prototypique" impliquant quatre participants A B C D, reliés entre eux par des attitudes d'ordre modal et psychologique. Opérant par métaphore ou métonymie à partir de ces quelques éléments, le motlav dérive un grand nombre de valeurs sémantiques, calculées par combinaison au contexte. Nous montrons à quel prix ce scénario, situé en amont de la phase de formulation, vient ensuite s'insérer dans des structures syntaxiques nécessairement étriquées : il en résulte diverses reconfigurations des relations actancielles. Dans l'ordre des opérations cognitives présidant à la constitution des énoncés, la syntaxe apparaît alors comme une phase secondaire dans la formulation, consistant à couler l'infini du dicible dans le moule étroit de catégories discrètes et limitées.

Pour qui cherche à décrire pour la première fois une langue sans tradition écrite, le lieu primordial où se manifeste le sens n'est ni le mot ni le morphème, mais l'énoncé contextualisé. La matière première du linguiste est donc la signification globale des énoncés en discours ; ensuite, et seulement ensuite, intervient la phase de segmentation et d'analyse syntaxique, au cours de laquelle on tente de distribuer cette signification globale en unités plus petites, internes à l'énoncé. À chaque fois, se pose la double question des limites de cette analyse : jusqu'à quel point peut-on pulvériser le signifié – le sème est-il une unité opératoire, ou seulement le sémème, ce paquet de sèmes associé globalement à un morphème ? Et jusqu'à quel degré peut-on éclater le signifiant : en accordant une valeur linguistique non seulement aux morphèmes euxmêmes, mais à leurs relations réciproques, à leur catégorie syntaxique, à leurs diverses appartenances sémantiques1 ?

1

Ces questions s'inspirent notamment de la réflexion d'Alain Lemaréchal (1989; 1997) autour de la superposition des marques, et de la sémantique de la syntaxe.

2

ALEXANDRE FRANÇOIS

1. Le morphème goy en motlav : lexique ou syntaxe ? Le motlav, langue océanienne (austronésienne) parlée au nord du Vanuatu par env. 1500 locuteurs2, présente de nombreux énoncés dans lesquels le verbe ou groupe verbal se termine par une syllabe [¥oM], transcrite /goy/, sans qu'il soit facile de lui attribuer une valeur sémantique stable. La première question est de savoir si cette syllabe est un morphème pourvu d'une signification unique, ou si l'on a plusieurs suffixes homonymes, dotés chacun d'un sens différent ; au pire, si cette tentative de motivation sémantique échoue, la récurrence de cette syllabe sera imputée au hasard. Il arrive, tout d'abord, que le test de commutation échoue, au sens où goy ne peut pas être supprimé du lexème verbal : galingoy "comploter", sisgoy "tomber", vatlêggoy "faire des fiançailles", tabeggoy "fermer", comportent obligatoirement cette syllabe finale /goy/, sans qu'il soit possible de rencontrer, ailleurs dans la langue, les mots *vatlêg, *galin, etc. Il est donc exclu de chercher à analyser ces verbes, du moins en synchronie – même si, au bout du compte, on y retrouvera le sémantisme de notre morphème. Cependant, la grande majorité des occurrences de goy – plus de 215 dans notre corpus spontané – laisse reconnaître un premier élément verbal V, par ailleurs autonome dans la langue : tiggoy "empêcher" [VT] rappelle tig "être debout" [VI] ; vapgoy "bénir" [VT] → vap "dire" [VT] ; etgoy "faire attention" [VI] → et "voir" [VT], etc. Du point de vue morphologique, tout se passe comme si l'on avait un (ou plusieurs) suffixe(s) goy, isolable(s) par commutation, et compatible(s) avec certains verbes pour en former d'autres. Si le procédé est entièrement productif, i.e. si goy peut se combiner à n'importe quel verbe au gré du locuteur, alors on y verra un morphème autonome, entrant avec le verbe V, à chaque fois, dans une relation syntaxique ; en revanche, s'il apparaît que seuls certains verbes sont compatibles avec goy, et/ou que la signification de l'ensemble /V+goy/ ne peut pas être calculée à partir de leurs sens respectifs, alors on parlera davantage d'un suffixe morphologique de dérivation lexicale. De fait, il apparaît que les deux interprétations sont possibles, ou plutôt qu'elles coexistent dans la langue : dans certaines de ses acceptions sémantiques qu'on verra plus loin (ex. Réactif ; Détrimental), goy est productif, et peut virtuellement s'associer à n'importe quel verbe ; dans d'autres (Secret ; "danser sur"), goy ne concerne qu'une poignée de verbes, lesquels sont appris par cœur avec cette valeur. Pour rendre la chose plus claire et élargir l'angle de vues, il semble déjà possible d'établir des comparaisons avec d'autres langues. Le comportement de goy ressemble assez à celui des préverbes des langues indo-européennes, ou des postverbes de l'anglais. Ainsi, les problèmes sémantiques – et syntaxiques, on le verra – que pose ce morphème du motlav sont du même ordre que ceux qu'implique, par ex., le postverbe anglais up : peut-on trouver un sens récurrent pour up dans les groupes verbaux climb up "grimper (vers le haut)", catch up "rattraper", pop up "surgir", give up "se désister", sit up "être assis droit", shut up "se taire" ? Ici, comme pour le motlav, il faut accepter une réponse contradictoire : d'un côté, up apparaît souvent dans des syntagmes colexicalisés et sémantiquement opacifiés, appris tels quels par les locuteurs ; de l'autre côté, certaines valeurs de ce même (?) up sont suffisamment récurrentes (ex. "vers le haut" ; "instantanément") pour permettre 2

Nous avons présenté en détails la morpho-phonologie de cette langue dans François (1999).

DÉRIVATION LEXICALE ET ACTANCE

3

aux locuteurs eux-mêmes de forger / interpréter de nouveaux syntagmes, par simple analogie. L'étude des langues ne cesse de révéler3 l'importance fondamentale, pour modéliser les comportements langagiers, de cette dualité entre formes opaques, apprises telles quelles par des locuteurs passifs, et transmises par "inertie" – et formes (re)motivées, associées, en amont et/ou en aval, à des règles plus ou moins productives, de la part de sujets cognitivement actifs. Cette ambivalence objets appris / objets construits recouvre en partie l'opposition classique4 entre lexique et syntaxe ; sauf que loin de s'opposer, ces deux fonctionnements langagiers apparaissent plutôt comme deux aspects, resp. synthétique vs. analytique, d'un seul et même mécanisme : la signification.

2. Problèmes sémantiques 2.1. Un casse-tête lexicologique Mais pour savoir que certaines valeurs de goy sont opaques en synchronie, il faut déjà avoir cherché à dégager celles qui lui sont associées le plus régulièrement : celles-ci formeront la signification nucléaire de ce morphème, la seule qui soit productive. Ainsi, pour l'anglais up, tout le monde s'accorderait à donner comme centrale la valeur "vers le haut", car elle est à la fois la plus fréquente et la plus transparente. En réalité, contrairement à la plupart des mots du motlav, goy oppose à l'analyse une incroyable résistance sémantique : les valeurs qu'on peut lui attribuer sont à la fois très nombreuses et difficiles à réduire à l'unité, comme le suggère le tableau suivant. Nous y présentons, d'un côté, le sens et la valence du verbe V, avant d'esquisser brièvement ceux que prennent les combinaisons de ces verbes5 avec le suffixe goy. VERBE

têy vap hag hoghog yo¾teg balbal tig hey mitiy et lak van

3

V

tenir dire être assis offrir entendre couper debout se vêtir de dormir voir danser aller

VALEURS DE V+ goy VT VT VI VT VT VT VI VT VI VT VI VI

VT retenir ; (se) couvrir (le visage…) VT interdire à ; bénir VT squatter (un endroit) ; assister (qqn) VT se fiancer à, se réserver (une femme) VT écouter attentivement VT couper (cheveux…) régulièrement se relever [VI] ; protéger ; empêcher [VT] VT revêtir (sa tête…) d'un habit VT se reposer de ; surveiller en dormant VT faire attention à ; s'occuper de VT danser sur (une musique) aller chercher [VT] ; (temps) s'écouler [VI]

Nous avions déjà relevé ce point dans un autre domaine linguistique, celui de la phonologie / morpho-phonologie (François 1999: 458). Andrew Pawley (1996; 1993) mène une réflexion poussée sur les limites de ces deux catégories ; les exemples qu'il cite sont assez proches des nôtres (séries verbales en Kalam, langue papoue non-austronésienne). 5 Par manque de place, nous présentons les verbes isolés plutôt que des énoncés complets ; ces derniers seront donnés en annexe, dans l'entrée goy du dictionnaire. 4

4

ALEXANDRE FRANÇOIS

Ces quelques exemples suggèrent la difficulté d'évaluer précisément l'apport sémantique de goy. Ce morphème reçoit tantôt des valeurs bénéfactives – "bénir", "protéger", "s'occuper de", "assister" –, tantôt des valeurs détrimentales – "empêcher", "interdire", "retenir", ce qui est déjà paradoxal. D'autres emplois ne se laissent pas classer facilement dans l'une ou l'autre de ces deux valeurs : "danser sur (une musique)" n'est ni bénéfactif ni détrimental, et l'on serait tenté de définir goy, faute de mieux, comme un vague "relateur syntaxique", correspondant aussi bien à nos prépositions sur, de, à, qu'à certains préverbes (re- dans retenir, revêtir, etc.) ; sans parler de significations qui ne sont guère "relationnelles", comme attentivement ou régulièrement… L'inconvénient d'une telle solution générale, si élégante soit-elle, est précisément d'être trop puissante : car même si la glose "relateur" réussit à englober tous les cas où goy apparaît, elle ne permet pas de comprendre ceux où goy est exclu. Surtout, elle ne fournit pas une modélisation satisfaisante des opérations sémantiques qui sont associées à ce mot, en termes de conditions nécessaires et suffisantes d'apparition dans le discours6. Il apparaît beaucoup plus fécond de supposer une signification première (très) précise, de laquelle les diverses acceptions de goy seraient dérivées, par figure stylistique (métaphore, métonymie) ou autre. Une première phase de l'exploration consiste à réunir ensemble les effets de sens qu'on peut considérer comme similaires : se constituent alors des familles d'énoncés7, caractérisées par une certaine cohérence interne – indépendamment des rapports existant entre ces familles. Voici un aperçu de cette première classification : – valeur ALLER CHERCHER : Na-trak so ni-van goy na-mtewot ! Il faut une voiture pour aller chercher un blessé ! • Kêy têvêy goy nô-mômô. Ils plongent chercher du poisson (ils font de la pêche sous-marine). • Nok so at goy na-plastik. Je me penche pour (prendre) le sac plastique. – valeur EMPÊCHER : Roland kê ni-têytêy goy kôyô. Roland les a empêchés (de se battre). • Nê-dêmdêm mino, ni-vit ni-akak goy. Ma pensée est obnubilée par les étoiles. • Mahê tô-qô¾ goy qiyig dôyô ! [la nuit va tomber sur nous] L'obscurité va nous empêcher de continuer ! – valeur REFERMER : qul goy no-totgal recoller une photo • gon goy na-mteê¼ verrouiller la porte …

Nous avons constitué pas moins d'une vingtaine de ces "familles d'énoncés", correspondant à autant (?) d'acceptions possibles pour goy. Ces 20 tiroirs sémantiques seront présentés en annexe, avec, à chaque fois, plusieurs énoncés représentatifs. Dans un deuxième temps, nous avons cherché à ordonner ces acceptions entre elles, afin de retracer un possible cheminement sémantique menant des unes aux autres, et dégager une éventuelle cohérence sémantique globale. Malgré le grand éventail de significations liées à goy, il nous est apparu possible de proposer une 6

C'est aussi là, sans doute, le reproche que l'on peut adresser à la façon dont J.-J. Franckel cherche à redéfinir abstraitement le préfixe re- ou le nom lit, en faisant appel à un nombre minimal d'opérations (Franckel & Lebaud 1992). 7 L'unité pertinente pour le linguiste, comme nous l'avons suggéré dans l'introduction, n'est pas le mot ni le syntagme, qui sont inclassables – ex. tig goy présente de nombreuses valeurs distinctes. C'est l'énoncé en contexte, seule unité qui soit dotée d'une signification stable pour l'observateur : dans tel énoncé précis, goy aura un effet de sens (éventuellement complexe) et un seul. Cf. Gross (1999: 117) : "postuler la phrase comme unité de base".

DÉRIVATION LEXICALE ET ACTANCE

5

hypothèse unificatrice, que nous présentons ci-dessous. Outre qu'elle rend assez bien compte de la plupart des 215 occurrences de notre corpus, cette hypothèse est confirmée par notre intuition de locuteur du motlav – intuition certes imparfaite, mais suffisante pour forger de nouveaux syntagmes en goy, et interpréter sans trop d'erreur des combinaisons inédites. Nous ne pouvons pas entrer ici dans les détails du raisonnement sémantique. Nous mentionnerons simplement un point concernant l'orientation vers les participants au procès, en vue de mieux aborder les questions syntaxiques qui suivront.

2.2. Un schéma général à quatre participants Dans un premier temps, nous partirons des acceptions (ou "familles d'énoncés") dans lesquelles l'apport sémique de goy est le plus net. Ainsi, si l'on examine l'ex. (1'), (1)

Nêk ma-hag. tu

PFT-assis

Tu es assis.

(1')

Nêk ma-hag goy tu

PFT-assis

goy

ni-vidio den

no !

la-télé

moi

ABL

Assis comme tu l'es, tu m'empêches de voir la télé !

on constate que goy modifie le comportement du verbe hag "être assis" de deux façons : – Apport sémantique : goy indique la conséquence de la première action "être assis", et particulièrement les effets sur autrui : en se trouvant dans telle position, le sujet (nêk) produit un certain effet sur qqn d'autre (no) – il le gêne. – Apport syntaxique : goy change la valence du verbe intransitif hag, pour constituer un verbe complexe hag goy, qu'on peut décrire comme transitif direct : "être assis devant (qqch) / occulter (qqch) en étant assis". Tout se passe comme si goy, au moins dans cet exemple, marquait une diathèse progressive, à effet transitivant

L'inconvénient d'une approche purement syntaxique de l'énoncé (1'), en termes de transitivité, est qu'elle n'entérine que l'ajout d'un actant, à savoir l'objet (ni-vidio) du verbe hag goy. Quant à la seconde addition, à savoir le syntagme prépositionnel den no "de moi", elle n'est pas censée entrer dans la valence de ce verbe : si l'on définit strictement la valence par le nombre d'actants directement régis par le verbe, on est simplement passé d'un verbe monovalent en (1), à un verbe divalent en (1'). Pourtant, l'intuition perçoit bien que le "circonstant" den no est également un apport de goy, d'autant plus qu'il est impossible en (1) ; même si c'est den qui semble introduire cet élément, sa signification dans l'énoncé se calcule, avant tout, à partir du suffixe verbal8. Par conséquent, on est tenté de considérer que le suffixe goy ne met pas en jeu simplement deux participants ("toi" et "la télé"), mais bel et bien trois ("toi", "la télé", et "moi"). Simplement, ces trois actants ne peuvent pas être associés directement au verbe, comme nous le verrons plus loin dans l'analyse syntaxique [§ 3.4].

8

De la même façon, il est admis que dans une phrase française comme J'ai donné le livre à ma sœur, le rôle sémantique qui sera attribué à "ma sœur" (Bénéficiaire, et plus précisément Donataire) résulte non seulement de la préposition à, mais aussi, c'est important, de la valence / du sémantisme de donner.

6

ALEXANDRE FRANÇOIS

L'énoncé (2') rappelle le type de relations sémantiques rencontrées en (1'), notamment entre le sujet et l'objet du verbe : (2)

Na-naw

na-hal.

la-mer

STATIF-flotter

La mer "flotte" (i.e. ne coule pas comme une rivière)

(2')

I¾glan,

na-naw

na-hal

goy.

Angleterre,

la-mer

STATIF-flotter

goy

L'Angleterre est une île. [lit. la mer flotte + fait obstacle]

On peut comparer terme à terme (2') et (1') : la mer est à l'Angleterre ce que "toi" était à la télévision, c'est-à-dire un obstacle. D'autre part, même s'il n'est pas syntaxiquement exprimé en (2'), on voit bien que goy a également introduit, du fait de son sémantisme même, un participant invisible : car présenter un X comme un "obstacle", implique nécessairement la référence à un sujet Y, celui-là même qui se trouve gêné par l'obstacle en question. En (1'), le sujet ainsi "empêché" était no ("moi") ; en (2'), c'est implicitement "les gens / on", tous ceux qui voudraient atteindre l'Angleterre en partant du continent. Comme nous allons rencontrer souvent ces mêmes relations sémantiques entre participants, indiquons déjà les symboles que nous avons choisis pour les désigner. Parmi les lettres arbitraires A B C D, qu'on verra plus loin, nous avons déjà rencontré :

DÉRIVATION LEXICALE ET ACTANCE

7

correspond bien à la définition sémantique (et à la description syntaxique comme COD) de l'élément B, en revanche le "chapeau" dont il est ici question n'a rien à voir avec celle de D : ce chapeau n'est pas le "gêné", mais le "gêneur", car il est utilisé pour protéger sa tête d'un danger extérieur (ex. le soleil, D). D'ailleurs, alors que D était marqué au moyen de la préposition ablative den en (1'), C est ici précédé de la préposition instrumentale mi, signalant la différence sémantique entre ces deux participants C et D. À strictement parler, on ne peut pas dire que C ("le chapeau"), dans l'énoncé (3'), résulte de l'adjonction du suffixe goy, puisqu'il était déjà présent en (3), comme objet de hey. Néanmoins, il est clair que cet élément C entre de plein droit dans la configuration sémantique associée au syntagme verbal V+goy. On peut l'ajouter aux trois éléments A, B, D déjà définis : – C : moyen par lequel A protège B contre D : instrument de l'action V+goy.

Pour abréger, on pourra gloser nos quatre éléments ainsi : A le protecteur ; B le protégé ; C la protection ; D l'agresseur.

2.3. Scénario prototypique et dérivation sémantique Ces quatre gloses métaphoriques permettent de définir, à partir des trois exemples précédents, un scénario prototypique11 associé au suffixe verbal goy, et mettant effectivement en jeu, au maximum, quatre participants :

– A : sujet du verbe V et du complexe verbal V+goy ; – B : chose qui se trouve cachée / recouverte / protégée par l'action V+goy ;

SCÉNARIO TYPIQUE de goy : Un sujet A recouvre un objet B au moyen d'un objet couvrant C, spéc. de telle sorte qu'il empêche, volontairement ou non, une tierce personne D d'accéder à B. D'où A interpose C pour protéger B et/ou pour repousser D.

– D : chose ou personne qui se trouve empêchée / gênée par V+goy.

Dans les deux exemples que nous venons de détailler, on observe des relations parallèles entre les participants : un agent9 A ("toi" / "mer"), de façon volontaire ou non, empêche une personne D ("moi" / quiconque) d'accéder à un objet B ("télé" / "Angleterre"). Dans les deux énoncés, l'objet syntaxique du verbe V+goy est B10, tandis que l'élément D se trouve soit périphérisé sous forme de circonstant (1'), soit complètement implicite (2'). Avant d'aller plus loin, faisons entrer un quatrième participant dans la bataille. Comparons à nouveau les verbes V / V+goy : (3)

Hey

na-hat

anen !

porter

le-chapeau là

Mets donc ce chapeau !

(3')

Hey

goy

ni-qti

mi

na-hat

porter

goy

ta:tête

avec

le-chapeau là

anen !

Protège-toi donc la tête avec ce chapeau !

Ce couple d'énoncés appelle nombre de commentaires, que nous verrons plus loin [§ 3.4]. Pour l'instant, contentons-nous de relever la pertinence sémantique d'un nouveau participant C, dans les énoncés en goy. En effet, s'il est vrai que "ta tête" 9

Le terme d'agent est à prendre ici au sens large, sans préjuger de la valeur agentive ou non du procès. Le motlav est une langue SVO à système "accusatif" / non-ergatif [cf. § 3.1]. 10 Dans l'énoncé (2'), cet objet est thématisé, puis repris par anaphore zéro sur le verbe ; cela est normal, en motlav, pour les objets inanimés. Cf. français Le cinéma, j'adore !

Il arrive, quoique rarement, que les quatre éléments A B C D soient tous explicités dans un même énoncé : (4)

Hey goy na-y¾ê

den

ne-nem

porter goy

ABL

moustique avec

tes:jambes

mi

na-trausis. pantalon

Protège-toi les jambes des moustiques avec un pantalon.

Mais le plus souvent, le scénario prototypique associé à goy ne se retrouve représenté que partiellement dans les énoncés, ou de façon métaphorique. Ainsi, en (1'), l'instrument couvrant C se confondait avec l'agent A, car celui-ci cachait B avec son propre corps. Ce sous-schéma se retrouvera souvent lorsque V est un verbe de position corporelle, sémantiquement statif : hag goy "empêcher l'accès en étant assis", tig goy "…en étant debout", en goy "…en étant allongé", etc. D'autre part, les valeurs psychologiques éventuellement associées aux gloses "A protège B pour repousser D", doivent être comprises comme renvoyant à une configuration prototypique, selon laquelle le protecteur A est plutôt , et protège un objet B plutôt , au moyen d'un objet C plutôt , contre un élément D typiquement . 11

Cf. le prototype chez Kleiber (1990), le sémème revisité par Touratier (1996) et les radial cognitive structures de Lakoff (1987).

8

ALEXANDRE FRANÇOIS

Nous verrons [§ 4.2] l'utilité de considérer comme centrales ces valeurs prototypiques, car c'est à partir d'elles que se constitueront divers effets de sens liés à goy. Cependant, il convient de souligner dès maintenant que chacune de ces catégories peut être "déformée" de façon métaphorique : ex. en (2'), la mer (A=C) n'est pas animée, et n'agit pas de façon consciente / agentive ; et doit-on vraiment considérer que cette mer "protège" l'Angleterre (B) de terribles agresseurs (D) venus du continent ? Nous laisserons ici cette question en suspens. Le détail des différentes acceptions de goy apparaît dans l'entrée du (futur) dictionnaire du motlav, reproduite ici en annexe. Les différentes acceptions de ce mot sont ordonnées, de façon à modéliser un cheminement sémantique vraisemblable, à partir du scénario prototypique que nous venons de reconstituer. Bien sûr, on se gardera bien de confondre ce dernier, sorte de dénominateur commun des emplois attestés en synchronie, avec un éventuel sens étymologique : celui-ci pourrait être très différent, tant il est vrai que les extensions et réanalyses sémantiques que connaissent les mots, au cours du temps, peuvent transformer leur configuration sémique12. D'ailleurs, l'étymologie de goy est connue : son étymon en POc (Proto-Océanien) est une racine *koro "village fortifié", donc sans doute un nom. Le développement de significations abstraites, et l'emploi comme second élément du syntagme verbal, serait propre aux (94) langues du Nord-Centre Vanuatu13 ; en outre, il semble bien que le motlav soit une des langues où cette extension sémantique ait été la plus radicale.

2.4. L'implication des participants : continu ou discret ? Pour chaque type d'emploi de goy, nous faisons précéder la définition par un schéma simple reprenant les quatre lettres A B C D. En réalité, chaque acception de ce suffixe est corrélée à une certaine configuration de ces quatre éléments, lesquels peuvent être présents, absents, ou encore présents d'une manière implicite (parenthèses) ou métaphorique (guillemets simples). Par exemple, le sens n°7 "s'approprier, rendre sacré, bénir" est estampillé du label [A, B, 'C', (D)]. Ce dernier signifie que dans cet emploi de goy, A et B sont normalement présents – i.e. soit explicités dans l'énoncé, soit implicités de telle sorte que l'auditeur reçoive l'instruction de les reconstituer. En revanche, l'instrument C, à savoir le moyen par lequel A s'approprie / sacralise B, a une valeur suffisamment métaphorique pour être simplement suggérée par le verbe, et rarement explicitée ; d'autre part, l'agresseur D est, certes, reconstituable, mais il n'a que très rarement de saillance discursive (pragmatic saliency) dans le discours. Ainsi, pour l'action de "bénir", les deux participants obligatoires sont A – le prêtre chrétien – et B – l'endroit hanté / la personne possédée / la nourriture ; on ne précise jamais C (les prières…), ni D (les esprits païens, la présence du Diable…), lesquels n'ont qu'une semi-présence du point de vue thématique. Parallèlement, tous les termes pour "se fiancer" emploient goy : akgoy, vatlêggoy, hoghoggoy. Il s'agit toujours, pour un jeune homme A, de se réserver / s'approprier une jeune fille B, en empêchant d'autres hommes (D) d'y accéder ; entre B et D, A interpose un mur symbolique C, à savoir des cadeaux de fiançailles – monnaie de

DÉRIVATION LEXICALE ET ACTANCE

9

coquillages ou billets de banque… – que le jeune homme offre (hoghog) aux parents de la femme. Néanmoins, on notera que C et D, même s'ils sont reconstituables, ne prennent jamais la forme d'un syntagme explicite : dans l'emploi normal de ces trois verbes "se fiancer", tout se passe comme si seuls deux participants étaient impliqués, à savoir A et B. En somme, dans l'action de bénir comme dans celle de se fiancer, on ne peut pas être sûr si l'on doit poser deux ou quatre participants. Dans ce cas comme dans d'autres, il faut accepter de considérer que l'on a des cas intermédiaires, où un participant n'est ni tout à fait impliqué dans une configuration, ni tout à fait absent. Il ne s'agit pas là d'une défaillance de la théorie, mais d'une prise en compte, dans la perception du monde, des différents degrés d'implication des participants dans le cadre du procès. C'est d'ailleurs cette variabilité sémantique qui permet de passer imperceptiblement, par exemple, du sens n°1 [A recouvre B avec un instrument externe C] au sens n°4 [A recouvre lui-même B] – cf. Annexe. Les sujets humains perçoivent et conçoivent des situations en nombre infini, dans lesquelles les éléments du monde se trouvent combinés à loisir. La difficulté que rencontre tout locuteur est de devoir traduire cette infinité, qui est de l'ordre du continu, en un nombre fini de représentations et de signes linguistiques, qui sont de nature discrète14. Le propre des structures d'une langue donnée est de proposer certaines catégorisations par défaut, afin de simplifier le travail d'expression du sujet locuteur : verbes traités comme a priori intransitifs vs. transitifs, systèmes de relateurs en nombre réduit, etc. Mais derrière ces catégorisations opérées par chaque langue, il importe au linguiste – à la manière de l'auditeur de l'énoncé – de pouvoir toujours reconstituer la continuité profonde qui unit entre eux ces éléments discrets, à un niveau cognitif que l'on peut appeler perception pré-linguistique du monde. En ce qui concerne notre goy, cette perspective théorique doit nous permettre de ne pas confondre deux choses : – la structure syntaxique des énoncés produits, dont les catégories sont discrètes : nombre n (0 / 1 / 2…) de compléments, présence [n°1] ou non [n°2 à 4] d'un instrumental. – la valeur référentielle de ces mêmes énoncés, où les gradations et continuums sont monnaie courante : participants plus ou moins impliqués, plus ou moins suggérés par le sémantisme du verbe, plus ou moins autonomes les uns par rapport aux autres [ex. si je me bouche les oreilles avec les mains, a-t-on 1 seul participant, ou 2 ou 3 ou 4 ?]

Précisément, s'il est vrai que nous avons, jusqu'à présent, concentré notre attention sur la signification de goy, et sur les mille facettes de ce kaléidoscope sémantique, il est temps d'observer de plus près la façon dont cette multiplicité de significations se trouve insérée dans le moule étroit de la phrase motlav. Qu'implique donc ce passage, pour ainsi dire, de l'infini référentiel au fini syntaxique ?

12

Robert Blust propose ici le concept de "fragmentation sémantique" (1987), en particulier à propos de la racine POc *koro (comm. pers.). 13 Cf. Pawley (1976), Clark (1985: 210) : outre un nom "enclos" bien attesté, ces auteurs citent les emplois comme prepositional verb "surround, cover, protect, shut, block, oppose, prevent, forbid".

14

Nous nous inspirons de la théorie sémantique d'Alain Lemaréchal, autour du pointillisme ou "points mis pour une surface" (1998a: 220, 225). Voir aussi la critique que fait Margetts (1999: 58) des représentations scalaires en typologie.

10

ALEXANDRE FRANÇOIS

3. Syntaxe : rôles sémantiques et valence 3.1. Syntaxe de la prédication en motlav Avant d'entrer dans le détail des questions de syntaxe relatives au morphème goy, quelques notes grammaticales vont nous permettre de nous situer au sein d'un système. Le motlav est une langue strictement SVO, dans laquelle le verbe est soit monovalent (SV), soit bivalent (SVO), sans possibilité de verbe trivalent à deux objets directs, du type I wrote the teacher a letter. La fonction S/O est indiquée exclusivement par la place du mot, sans morphème casuel. Outre le COD, le motlav peut faire suivre le verbe de divers compléments, soit directs (Locatifs), soit introduits par une préposition : (Directionnel +) hiy Datif ; bE- Final ; mi Instrumental ; den Ablatif… Cf. (4) supra. Si la place de Sujet n'appelle pas de remarque particulière, celle de V dans la formule SVO, doit être davantage précisée. Mieux vaut parler ici de Syntagme Prédicatif (SPrd), pour plusieurs raisons : – d'autres parties du discours que le verbe sont prédicatives en motlav : notamment les noms, adjectifs, locatifs. Il s'agit d'une langue omni-prédicative ; – le prédicat, qu'il soit verbal ou non, est rarement constitué par un simple mot, mais par un syntagme à trois éléments. Voici ces trois éléments, dans l'ordre de la chaîne : 1] des marques T.A.M. (Temps-Aspect-Mode) pour les prédicats T.A.M. – surtout verbes, adjectifs ; 2] la tête prédicative : verbe, nom, adjectif ; locatif… 3] l'Adjoint du Prédicatif, suivant immédiatement la tête, et modifiant la signification de cette dernière de façon diverse, à la façon d'une épithète.

En résumé, on observe typiquement des énoncés comme celui-ci : (5)

No [mal DÊM je

ACP

veteg ]

réfléchir (laisser)

nê-vêygêl namu-ndô. la-querelle de-nous2

J'ai déjà tiré un trait sur notre querelle (de naguère).

On reconnaît successivement les trois parties principales de la phrase motlav : Sujet ; syntagme Prédicatif ; Compléments (ici le COD). Le SPréd se compose lui-même d'une marque TAM (mal), d'une tête verbale (dêm), et d'un Adjoint du Prédicatif (AdP), le mot veteg.

3.2. L'Adjoint du Prédicatif : sémantique et valence C'est cette position d'AdP qui nous intéresse ici. Celle-ci, propre à la syntaxe du motlav, peut être remplie soit par un verbe (deuxième verbe d'une sérialisation), soit par un adjectif (indiquant la manière de V1), soit par un nom (surtout objets incorporés) ; mais on ne peut trouver comme AdP ni syntagme nominal / prépositionnel, ni complément d'aucune sorte. Et l'on notera qu'aucun complément ne peut séparer un AdP du verbe précédent. D'autre part, certains mots se rencontrent exclusivement dans cette position, et ne sont ni noms, ni adjectifs, ni verbes : c'est le cas du suffixe galsi "(faire V1) comme il faut", ou de veteg en (5). C'est enfin le cas – ne le perdons pas de vue – de notre goy,

DÉRIVATION LEXICALE ET ACTANCE

11

dans tous ses emplois : la seule position syntaxique où apparaît ce morphème, est celle d'Adjoint du Prédicatif. Tous ces AdP ont pour point commun d'ajouter certains sèmes à la tête prédicative : qu'il s'agisse de "(faire V1) comme il faut" / "en même temps qu'une autre action V2" / "par réaction"…, le premier apport de ces AdP est d'ordre sémantique. Cependant, dans certains cas, cet apport sémantique s'accompagne d'une reconfiguration syntaxique regardant la valence de V1. C'est le cas, revenons-y un instant, en (5) : alors que dêm "réfléchir" est lui-même un verbe intransitif dans cet emploi, veteg le transitivise, en donnant au syntagme verbal dans son ensemble une valence double – dêm-veteg "réfléchir de façon à volontairement laisser (qqch)" > "oublier (volontairement), pardonner". Ce comportement est le même si V1 est un verbe de mouvement monovalent : (6)

Nêk [ma- VAN veteg ]

kemem

ba-hap ?

tu

nous

pour-quoi

PFT

aller

(laisser)

Pourquoi nous as-tu abandonnés ? [tu es parti laissé nous]

Même si veteg n'est pas – ou plus15 – un verbe en synchronie, il a du moins le pouvoir de modifier la valence du verbe qu'il accompagne. Son comportement fait penser à celui de certains préverbes latins, dont l'effet est parfois de rendre transitif un verbe intransitif ; Ernout & Thomas (1953: 21) citent notamment les "verbes composés" ad-ire, ob-ire, ad-loqui, per-currere, tous suivis de l'accusatif, contrairement à leur verbe simple. Les deux auteurs expliquent cette "influence de la composition" par le fait que : en plus de l'idée de mouvement qui souvent subsiste, la notion évoquée par le composé est celle d'un verbe transitif : par exemple, inire uiam ou suscipere negotium impliquaient l'idée d'un verbe "faire" [nous soulignons, A.F.]

En des termes plus modernes, on dira que l'ajout d'un Adjoint du verbe (préverbe en latin) crée une relation actancielle supplémentaire, en sorte que le procès se trouve en quelque sorte "indexé" sur un nouveau participant, qui se trouve affecté par ce procès.

3.3. Des morphèmes applicatifs ? C'est exactement le cas de veteg en (6) : alors que l'action de partir n'implique qu'un seul participant (celui qui part), l'ajout de cet AdP permet en outre d'indexer cette même action vers un second participant, à savoir la personne (kemem) que l'on quitte en partant. Ce comportement syntaxique de diathèse progressive rappelle assez bien le problème des Applicatifs, ces morphèmes intraverbaux permettant de promouvoir à la place d'objet un participant extérieur (?), qui serait sans cela traité comme un circonstant16. Néanmoins, bien que cette comparaison avec les Applicatifs soit séduisante, elle a l'inconvénient de franchir trop vite la distance qui sépare le lexical du grammatical : alors que le propre d'un Applicatif est d'être compatible avec un grand nombre de verbes et de relations différentes, un mot comme veteg continue, malgré tout, à n'être employé que dans un très petit nombre de cas (faibles en extension, larges en compréhension).

15

Une enquête auprès de langues voisines comme le mosina (8 locuteurs, cf. François 1999) donne pour veteg une valeur de verbe transitif "poser, déposer". 16 Cf. le peul, le nahuatl, le kinyarwanda.

12

ALEXANDRE FRANÇOIS

En outre, comparons les trois énoncés suivants, dans lesquels l'AdP a un effet transitivant sur le verbe V1 "aller" : (7a) Kê il

[ma- van PFT

aller

V1 hag

veteg ] na-gasel nono-n. (laisser)

le-couteau

de-lui

Il est parti en oubliant son couteau.

(7b) Kê il

[ma- van PFT

aller

têy tenir

] na-gasel nono-n. le-couteau

de-lui

Il est parti avec son couteau à la main.

(7c) Kê il

[ma- van PFT

aller

goy ?

] na-gasel nono-n. le-couteau

de-lui

Il est parti chercher son couteau.

Il est donc difficile de parler d'Applicatif pour veteg, car sa valeur reste largement spécifique. Nous dirons d'ailleurs la même chose pour goy, même si l'élargissement sémantique lié à certains de ses emplois rend bien tentante cette étiquette. Du moins, pouvons-nous désormais inscrire dans ce type de problématique actancielle, les remarques suivantes sur la syntaxe de ce goy.

17

Nous avions déjà développé des raisonnements similaires en théorie phonologique (François 1999) : il s'agissait de faire entrer des phonèmes dans des schémas syllabiques contraignants, à nombre de places limité. Ces phénomènes de "chaises musicales" mettent à jour la tension fondamentale, à l'œuvre dans tout le langage, entre un désir de "tout dire" qui tend vers l'infini – et, d'autre part, des catégories simples et limitées, en nombre beaucoup plus restreint.

AdP ×

V1-AdP =

goy

hag-goy

Préposition

+

den

assis

s'interposer

occulter

éloigné

A

A B D

A B

B D

Parmi les diverses relations existant entre les participants (A-B, B-D, A-D, A-B-D), l'énoncé final n'en code que deux, nécessairement binaires – puisque les relateurs ternaires n'existent pas. Il en résulte une réorganisation de toute la valence du groupe, et un décumul des relations actancielles sur plusieurs morphèmes18. Ce n'est pas tout. Nous venons de prendre un exemple simple, dans lequel V1 était lui-même intransitif. Mais que se passe-t-il si ce premier verbe a un complément d'objet ? Ce cas de figure est représenté par les ex. (3')/(4) ci-dessus. On a le schéma suivant : V1 hey

3.4. Le jeu des chaises musicales Le mécanisme de diathèse progressive que nous venons de montrer avec veteg est simple, et ne semble pas poser de problème. En effet, ce mot vient ajouter un actant supplémentaire à un verbe V1 qui est normalement monovalent, puisqu'il s'agit surtout de verbes de mouvement (aller, partir, courir, sauter…) ; dès lors, la combinaison de {Valler(x) + AdPlaisser(x,y)} donne naturellement un verbe complexe {[V+AdP]quitter(x,y)} à deux places d'arguments. Ce verbe complexe pourra se co-lexicaliser, sans difficulté, sous la forme d'un verbe transitif comme un autre : ainsi yow-veteg "bondir-laisser" s'est lexicalisé comme verbe bivalent "fuir (qqn, qqch)". L'essentiel, ici, est de constater combien cette première combinaison est simple, puisqu'un prédicat monovalent f(x) + un prédicat bivalent g(x,y), dans la mesure où ils partagent un de leurs arguments, donneront sans difficulté un nouveau prédicat bivalent. L'affaire se corse avec un morphème comme goy. D'une part, nous avons vu que ce mot n'ajoute pas un seul nouvel argument, mais deux, voire trois. Or, nous avons vu que le motlav interdit les verbes à plus de deux places d'arguments : on se retrouve donc dans un jeu de chaises musicales, où trois participants doivent s'asseoir sur deux chaises au maximum17. Le restant n'a pas d'autre choix que de figurer en dehors du syntagme verbal, et de trouver une nouvelle relation f susceptible de l'accueillir : ce sera généralement le cas avec une préposition (den, mi…). Ainsi, si l'on reprend nos exemples et nos notations du début, on formulera l'exemple (1') ainsi :

13

DÉRIVATION LEXICALE ET ACTANCE

AdP ×

goy

V1-AdP =

hey-goy

Prép1

+ mi

Prép2 (+ den)

revêtir

interposer

protéger

utiliser

(éloigné)

AC

A B C (D)

AB

AC

(B D)

3.5. La stratégie sérielle Outre la préposition, une stratégie légèrement différente employée pour décumuler les relations est de créer une place supplémentaire en coordonnant deux propositions, l'un des deux verbes assumant l'une des relations en jeu : (8)

Nêk

yêt

no-yot

tu

nouer

les-feuilles:de:sagoutier

…

Tu attaches ensemble les feuilles [de sagoutier]

(8')

Na-tmatwoh, le-tambour

lep no-yot tô yêt goy na-mtan. prendre (feuilles) alors nouer goy son:œil

Le tambour (à membrane), on prend des feuilles et on (les) attache sur / on (en) recouvre son ouverture.

En (8), la relation entre A (celui qui fabrique le tambour à membrane) et C (les feuilles de sagoutier) est assurée normalement par le verbe transitif yêt "nouer" : on n'a pas de mal à y voir un Agent et un Patient, du moins dans cette première phrase. Mais en (8'), l'adjonction de goy évince ce même C de la place d'objet de yêt, en réorientant l'ensemble yêt-goy vers un autre participant (orientation secondaire) ; la place unique d'objet de ce verbe est alors réservée à B, second élément affecté par l'opération, à savoir l'orifice du tambour. En termes fillmoriens, une question fondamentale consisterait à se demander si B reste le "Bénéficiaire" de l'action yêtgoy, et C son Patient (on aurait alors un cas d'Applicatif ?), ou bien si l'on n'assiste pas tout simplement à la définition de nouvelles actions : au bout du compte, l'action de yêt-goy est envisagée non pas dans ses effets sur C – qui est donc ravalé au rang d'Instrument – mais dans ses effets sur B – qui se trouve promu non seulement comme Objet en termes syntaxiques, mais également, c'est important, comme Patient en termes sémantiques. 18

Pour cette notion, et le cadre théorique de notre analyse, voir Lemaréchal (1998a, 1998b).

14

ALEXANDRE FRANÇOIS

DÉRIVATION LEXICALE ET ACTANCE

Quoi qu'il en soit, la relation entre A et C se trouvant périphérisée hors du procès yêt-goy, celle-ci doit être soit simplement implicitée, soit représentée ailleurs dans le contexte. C'est là le rôle de la première proposition lep no-yot, laquelle rappelle nettement les séries verbales de langues comme le chinois ou le yoruba19, et à vrai dire de bien d'autres langues encore. On obtient le schéma : V1 yêt

AdP ×

goy

Vo =

lep

V1-AdP +

yêt-goy

nouer

entourer

prendre

recouvrir

AC

ABC

AC

AB

On voit donc qu'un suffixe verbal comme goy, du fait de son sémantisme fondamental à quatre participants, est capable d'occasionner de profondes restructurations syntaxiques au sein de la phrase. Allons plus loin : s'il y a un sens à chercher une priorité dans les opérations cognitives, gageons que, pour constituer un énoncé particulier, la sémantique se situe toujours en amont de la syntaxe – laquelle se plie tant bien que mal à un projet énonciatif constitué en dehors d'elle. Bien sûr, cette idée appelle la discussion.

4. Diathèse et prototype 4.1. Une orientation ambiguë Cependant, le point le plus original concernant la syntaxe de goy reste à venir. Jusqu'ici, tous nos raisonnements semblaient admettre le même mécanisme : le groupe verbal [V+goy] constitue un verbe transitif, dont le Patient est un objet qui se trouve sémantiquement recouvert/ protégé, c'est-à-dire B ; tout autre participant est exclu de la position de COD, et en particulier l'ancien Patient de V se trouve éjecté par cette opération. Enfin, un dernier participant introduit par ce même goy, à savoir D (l'agresseur), se retrouve périphérisé, en position de circonstant. Cette description est exacte pour une bonne partie des emplois de goy, environ la moitié : les effets de sens "entourer / protéger / se fiancer / bénir / aller chercher / pour…" [cf. Annexe, n°1 à 11], sont tous justiciables de cette même analyse syntaxique. Et pourtant, la surprise que nous offrent tous les autres emplois de goy [n°12 à 20], c'est de ne plus être orientés – au sens de l'orientation secondaire, vers l'Objet (Lemaréchal 1989) – vers le protégé (B), mais vers l'agresseur (D). Pis encore : le même verbe complexe [V1+ goy] pourra être suivi d'un complément d'objet référant tantôt à B, tantôt à D : (9)

Kêy mi-tig

goy

na-tmat

den

Wilson.

ils

goy

les-masques

ABL

W.

PFT-debout

Ils ont protégé les masques sacrés contre Wilson.

19

Cf. l'ex. Mo fi àdè bé igi "I took machete cut tree", de Givón (1984: 179), repris par Lemaréchal (1998a: 207). Cependant, nous réservons le terme de série verbale en motlav à une combinaison V1-V2 au sein du groupe Prédicatif, et donc sans aucun objet séparant ces deux verbes ; l'ex.(8') est simplement une séquence de deux propositions coordonnées.

(9')

Kêy mi-tig

goy

Wilson hag

le-tno plên.

ils

goy

W.

à-lieu

PFT-debout

Est

15

avion

Ils ont barré la route à Wilson là-bas, devant l'aéroport.

Ces deux énoncés relatent le jour où les chefs de Motalava empêchèrent un anthropologue américain d'emporter hors de l'île les masques sacrés qu'il venait d'acheter. En (9), l'objet du verbe complexe tig-goy est B, en sorte qu'on le traduira "protéger", "sauver" ; en (9'), le même verbe est orienté vers D, et il s'agit cette fois non plus d'agir pour quelqu'un, mais contre. Ce dernier cas de figure, à savoir le verbe [V+goy] orienté vers l'agresseur D, est à la source de multiples effets de sens : empêcher, interdire, tenir à l'écart ; mais aussi des valeurs plus abstraitement détrimentales, d'une part, et réactives, d'autre part. On comprend maintenant pourquoi le même morphème goy, dans le Tableau p.3, présentait paradoxalement des valeurs tantôt Bénéfactives [bénir ; se couvrir (le visage) ; surveiller], tantôt Détrimentales ou assimilées [interdire ; retenir qqn ; se reposer de] – et ce, avec parfois les mêmes verbes [respectivement vap, têy, mitiy].

4.2. Efficacité du prototype En ce qui concerne les emplois particuliers de ce goy, que nous ne pourrons développer ici, nous renvoyons encore une fois aux exemples donnés en Annexe. Simplement, dans la lignée de notre démonstration sur la valence et la diathèse liées à ce morphème, nous nous interrogerons sur les critères précis permettant de distinguer le rôle sémantique de B vs. D, dans des couples d'énoncés comme (9)-(9'). En effet, si l'objet de [V+goy] était systématiquement B, comme on a pu le croire d'abord, alors ce B serait facilement reconnaissable – selon un raisonnement d'ailleurs circulaire – par sa fonction syntaxique d'objet ; mais ce n'est pas le cas. Sur quels critères nous basons-nous donc pour classer les emplois abstraits de goy, et décider qu'ils impliquent B vs. D ? Et du point de vue théorique, est-il raisonnable de conserver cette distinction entre deux rôles sémantiques, lors même que leur traitement formel ne semble pas les distinguer particulièrement ? C'est ici qu'intervient à nouveau la notion de prototype. Lorsque nous avons défini le scénario typique de goy [§ 2.3], nous avons volontairement éliminé l'analyse componentielle en termes de conditions nécessaires et suffisantes d'apparition de ce mot. Nous avons préféré adopter une approche cognitiviste, dans laquelle les liens unissant toutes les acceptions de goy ne sont pas de l'ordre du vrai / faux, mais du semblable / dissemblable. En particulier, nous avions défini chacun des quatre participants A B C D par un ensemble de traits prototypiques : A serait plutôt , etc. Or, nous soutenons que le prototype continue d'exercer sa "puissance attractive", pour ainsi dire, même dans les emplois les plus abstraits / dérivés / métaphoriques d'un morphème. En l'occurrence, un trait qui permet de tracer la frontière entre B et D, est le fait que B sera toujours du côté de l'inanimé non-agentif – objet à protéger [cf. sens n°6; 7], lieu [n°3] ; personne soumise [n°7; 8], malade ou fragile [n°9 à 11] – tandis que D se reconnaîtra systématiquement à son caractère typiquement animé / actif. Ce trait ACTIF signifie que D est toujours celui qui essaye de faire une action VD, à laquelle A vient réagir : d'où les valeurs "empêcher", "interdire", mais aussi "en réaction" [n°16 à 19].

16

ALEXANDRE FRANÇOIS

4.3. Illusions d'optique L'intérêt de cette approche par le prototype, est qu'elle permet de retracer le cheminement cognitif d'un énoncé comme le suivant : (10) Ige les

ta¼an

haw

goy

na-he-k.

hommes

danser

goy

ma:chanson

Les hommes viennent danser sur ma chanson. (sur la chanson que l'on chante en mon honneur)

En effet, que faire ici de na-he-k ? C'est l'objet du verbe complexe haw goy "danser le no-yo¾yep sur (telle ou telle musique)", mais quel rôle sémantique lui attribuer à l'origine, si l'on admet notre schéma à quatre participants – et que l'on est prêt à jouer le jeu jusqu'au bout ? À première vue, il n'y a pas plus de raison de voir en cette chanson un B (un protégé) qu'un D (un agresseur), pas plus d'ailleurs qu'un C (une protection)… On est alors tenté d'abandonner la partie, et de considérer que cet objet vient de nulle part. Au mieux, rapprochant cet emploi du n°11, on fera de goy un Applicatif, susceptible d'ajouter une place d'argument à n'importe quel verbe intransitif, quel que soit le sémantisme des actants. L'ennui, c'est que cette dernière solution est fausse : goy a certes pour effet de transitiver un grand nombre de verbes monovalents, mais pas tous. Qui plus est, cette analyse fait comme s'il y avait un sens à vouloir "transitiver" un verbe de façon mécanique, indépendamment des sèmes en jeu. En réalité, la clef de l'exemple (10) se trouve dans le sens du nom na-he-k ("chanson en mon honneur"), ou plus exactement dans sa valeur précise en contexte : car "danser sur une chanson", implique nécessairement que cette chanson est en train d'être chantée au moment même de la danse. La danse est donc une forme de réaction de A à une action d'autrui (le chant), et peut donc être rapprochée d'autres exemples [n°16, 17] où goy acquiert certaines valeurs aspectuelles d'ailleurs tout à fait remarquables : à partir de la valeur primitive Un agent A réagit à une première action (agressive ou non) d'un autre agent D, se constituent des mécanismes de repérages inter-procès – du type "Moi j'envoie, et toi tu reçois." / "Toi tu chantes, et moi je danse (en réaction)". Dans ce cas de figure, goy est devenu sinon obligatoire, du moins ordinaire, pour marquer la simultanéité / complémentarité de deux procès P1 et P2. On mesure l'incroyable chemin parcouru, pour atteindre ces significations d'ordre aspectuel, depuis les premières significations de goy, type recouvrir, protéger – pour ne rien dire de l'étymologie *koro "village fortifié" ! En revanche, si c'est bien un "D" qu'il faut reconstituer dans l'exemple (10), une analyse différente est nécessaire pour expliquer les énoncés regroupés sous n°11 : car dans une phrase comme "Il s'est mis en colère pour (défendre) son fils", le fils en question est beaucoup plus proche d'un participant de type B (protégé, inactif, soumis…) que de type D. En sorte que, malgré les apparences, il faudra analyser séparément deux emplois de goy [n°11 ≠ 18] qu'une approche étroitement syntaxique aurait trop tôt assimilés : se prévalant de l'effet "transitivant" de goy dans les deux cas, on eût été tenté de rapprocher les deux types d'exemples, au risque de mettre à mal la prégnance du scénario global que nous avions proposé pour ce mot [§ 2.3].

DÉRIVATION LEXICALE ET ACTANCE

17

5. Conclusion : que la syntaxe n'est pas première Dans cette étude de goy en motlav, il est apparu que l'analyse linguistique ne peut pas se contenter de partir des structures pour remonter aux énoncés particuliers, mais doit faire exactement l'inverse : en postulant comme unité fondamentale l'énoncé contextualisé, on cherche à définir précisément les sèmes qui, disséminés dans chaque situation réelle, accompagnent régulièrement telle ou telle marque. Par exemple, malgré ses allures de morphème grammatical, il est impossible de définir goy en termes de valence syntaxique (type Applicatif), ou d'y voir un exemple de "relateur" sans limites précises. En fait, l'apparition de ce morphème dans le discours est liée à des indices contextuels précis – mais prototypiques – qui opèrent bien avant l'insertion dans des structures phrastiques contraignantes : présence d'un danger ; désir de protéger un objet prisé ; attitudes psychologiques défensives, réaction à une action étrangère ± offensive ; notion d'obstacle, etc. Ceci nous persuade encore davantage que les relations syntaxiques au sein de l'énoncé ne se situent jamais en amont de la formulation, mais plutôt – pour peu que cette formule ait un sens – en aval. Imaginer qu'un morphème puisse être en luimême un "pur outil grammatical" (par exemple à effet transitivant), et seulement ensuite se gorger de signification contextuelle, nous semble une perspective erronée sur le fonctionnement de la langue, car elle se priverait d'une épaisseur sémantique indispensable à sa compréhension. Certes, goy a des effets transitivants, sur presque tous les verbes qu'il touche ; certes, il a également pour effet de réorganiser les structures actancielles au sein de la phrase. Mais, tout bien considéré, ces petits événements syntaxiques ne sont que des épiphénomènes, effets secondaires des véritables réactions chimiques à l'œuvre dans les énoncés : les rencontres de sèmes. Alexandre FRANÇOIS LACITO-CNRS

/ Paris-IV 22, Chemin de la Justice 92290 Châtenay-Malabry

Bibliographie BLUST, Robert. 1987. "Lexical reconstruction and semantic reconstruction: the case of Austronesian 'house' words". Diachronica 4, 79-106. CLARK, Ross. 1985. "Languages of North and Central Vanuatu : groups, chains, clusters and waves". In A. Pawley & L. Carrington (eds), Austronesian linguistics at the 15th Pacific Science Congress. Pacific Linguistics. Canberra: A.N.U., 199-236. ERNOUT, Alfred & THOMAS, François. 1953. Syntaxe latine. Paris: Klincksieck. FILLMORE, Charles. 1968. "The case for case". In E. Bach & R. Harms (eds) Universals in Linguistic Theory. New York: Holt, Rinehart & Winston, 1-90. FRANCKEL, Jean-Jacques & LEBAUD, Daniel. 1992. "Lexique et opérations: Le lit de l'arbitraire". In La théorie d'Antoine Culioli: Ouvertures et incidences. L'homme dans la langue. Gap: Ophrys, 89-105. FRANÇOIS, Alexandre. 1999. "Mouvements et clonages de voyelles en motlav: Entre phonologie et morphologie". Bulletin de la Société de Linguistique XCIV, 1, 437-486. Paris: Klincksieck. GIVÓN, Talmy. 1984. Syntax. A functional-typological introduction. Amsterdam / Philadelphia: Benjamins.

18

ALEXANDRE FRANÇOIS

GROSS, Gaston. 1999. "Elaboration d'un dictionnaire électronique". Bulletin de la Société de Linguistique XCIV, 113-138. Paris: Klincksieck. KIMENYI, Alexandre. 1980. A Relational Grammar of Kinyarwanda. Berkeley: University Press of California. KLEIBER, Georges. 1990. La sémantique du prototype, Catégories et sens lexical. Paris: PUF. LAKOFF, George. 1987. Women, Fire and Dangerous Things: What Categories reveal about the Mind. Chicago, London: University of Chicago Press. LEMARÉCHAL, Alain. 1989. Les parties du discours, Syntaxe et sémantique (coll. Linguistique Nouvelle). Paris: PUF. LEMARÉCHAL, Alain. 1997. "Superposition des marques, zéro et morphologisation". Mémoires de la SLP, V, 25-61. LEMARÉCHAL, Alain. 1998a. Études de morphologie en f(x,...) (coll. Bibliothèque de l'Information Grammaticale). Louvain-Paris: Peeters. LEMARÉCHAL, Alain. 1998b. "Théories de la transitivité ou théories de la valence: Le problème des applicatifs". In A. Rousseau (ed.) La transitivité. Lille: Presses du Septentrion, 203-218. MARGETTS, Anna. 1999. Valence and Transitivity in Saliba (coll. MPI Series in Psycholinguistics): Max-Planck Institut. PAWLEY, Andrew. 1976. Some new Oceanic comparisons (non publié). PAWLEY, Andrew. 1993. "A language which defies description by ordinary means". In W. Foley (ed.) The role of theory in language description. Trends in Linguistics. Berlin: Mouton de Gruyter, 87-129. PAWLEY, Andrew. 1996. "Grammarian's lexicon, lexicographer's lexicon: Worlds apart". In J. Svartvik (ed.) Words: Proceedings of an International Symposium. Konferenser. Stockholm: Kungl. Vitters Historie och Antikvitets Akademien, 189-211. TOURATIER, Christian. 1996. "Sémème, polysémie et théorie du prototype". Bulletin de la Société de Linguistique XCI, 77-96. Paris: Klincksieck.

LEXICAL DERIVATION AND VALENCY-CHANGING STRATEGIES: TAILORING SYNTAX TO – The description of unknown languages reveals the methodological importance, including for general and typological linguistics, of considering individual contextualised sentences as the fundamental unit for the observation of meaning. This method proves to be powerful in analysing the very meaning and mechanisms associated to an incredibly challenging suffix in Motlav (Oceania). This verbal suffix goy recalls the syntax-andsemantics issues related to preverbs in European languages, to serial verbs or to applicative morphemes found in several parts of the world. Therefore, this study approaches both realms of lexical semantics and of syntactic transitivity.

SEMANTICS

Our definition of the suffix goy takes the form of a "prototypical scenario", involving four semantic roles A B C D, mutually related by specific mood attitudes. Through metaphoric or metonymic patterns, Motlav derives from this scenario a fair number of semantic values, in accordance with each context. Starting from this first semantic stage, we show the kind of selections and transformations implied when the speaker inserts this scenario into the limited syntactic structures : the necessity of matching semantic roles with grammatical functions triggers several valency-reshaping strategies inside the sentence. In an attempt to give a model for the cognitive operations involved by linguistic communication, we eventually consider syntax to be a secondary stage in the process of formulation. First of all comes the non-limited, fuzzy representation of a semantic project ; then, the syntactic stage provides a set of limited, discrete categories, which just adapt as they can to fit that semantic project.

DÉRIVATION LEXICALE ET ACTANCE

19

NAMYÔS MINO, SO NOK SO DÊMDÊM HIY NA-VAP TO-½OTLAP VITWAG, A SO GOY EN – Veg ½otlap gên yo¾yo¾teg vel qô¾ no-hohole qele so 'Etgoy kê', si so 'Nok higgoy nêk' si so 'Kemem hoghoggoy na-lqôvên', si 'Kêy tô-¼ôl la-halgoy', ba 'Nok so salsalgoy n-ê¼ mino'. Ba nê-vêvêhiy mino so : na-manig ne hohole en na-hap ? Veg na-vap non ige qagqag ne-tegha, na-vap te-le-lam ne-tegha, na-vap nongên ne-tegha. Ba nok so galeg no-yobem liwo bi-tiy gatgat nongên en, no te-leh no-hohole en mi na-han hohole nonmem ? Bastô nok dêmdêm lôlhiy na-kastom to-½otlap, ba ige te le-Pnô Tamtam en kêy togtog namuy qele ave geh, ba vel qô¾ kêy akakteg geh. L-etet mino, na-manig ne 'goy' en, ni-tiy kê qele gên : so nêk etetgoy na-hapqiyig vitwag, ba n-et tegha so ni-van me so ni-bel si so ni-ak hethet so ni-akteg en, tô inêk nêk tiggoy lok kê so kê tiple têytêy van na-ge nan en, a nêk boboel goy en. Ba no mal dêm sas êgên : tô nok êglal so ba-hap tô gên vap so 'akakgoy na-lqôvên', so 'dô hohole galingoy den kê', so 'Nok ti, kêy ti goy', si so 'Kem so haw goy na-he'... No ne-mlaklak a ni-lwo, veg no mal dêm sas ni-tiy dêmdêm ne gatgat nongên, tô no ta-yap vêh no-yobem vitwag mey nê-wê. Vêwê kimi.

ANNEXE Extrait du (futur) Dictionnaire Motlav-Français : entrée goy.

goy1 [¦oM] adp. (toujours suffixé à un verbe V). || Schéma gén. un sujet A recouvre un objet B au moyen d'un objet couvrant C, spéc. de telle sorte qu'il empêche, volontairement ou non, une tierce personne D d'accéder à B. D'où A interpose C pour protéger B et/ou pour repousser D. Les divers sens de goy résultent en partie des diverses combinaisons entre ces éléments. [POc *koro 'village fortifié ; ceindre'] 1) [A,B,C] couvrir, recouvrir, entourer, ceindre (qqch) avec un instrument enveloppant, la nature de cet instrument étant explicitée dans la phrase. • Na-tmatwoh, lep no-yot tô yêt goy na-mta-n. Le grand tambour, on prend des feuilles de sagoutier et on les attache (yêt) de façon à couvrir (goy) son orifice. • Hey goy ni-qti mi na-hat anen! Protège-toi donc la tête avec ce chapeau! • Nêk wêdê goy no mi ne-vet. [conte] Recouvre-moi de pierres (dans le four, cf. wdê). 2) [A,B,(C)] idem, la nature de l'instrument enveloppant étant suggérée par le verbe V. • Kem me-geay goy nê-vêtan, kê tale sisgoy soloteg. Nous avons clôturé (geay 'clôture') la terre, de peur qu'elle ne s'effondre de tous côtés. • Kê me-bey goy kê. Elle s'est ceinte d'une jupe (bey). 3) [A,B,(C) Geocentric strategy. The ²rst case to be examined is the relation between (a) the personal strategy and (c) the geocentric strategy. When a given event is both oriented toward a participant X and along a horizontal axis that could be represented in geocentric terms, it appears that the personal directionals will always take priority over the geocentric ones. This can be seen, for example, in the following context. Speaker A and speaker B were both sitting at a table, facing each other. On each side of the square table was a teacup, as represented in ²gure 3; the geocentric coordinates of the test setting are also indicated. B asked A to designate verbally each teacup on the table. The two cups placed on the sides of the table where nobody was sitting (i.e., ii and iv) would be designated through geocentric coordinates: (28) a. na-ba§kên mey hag art-cup

rel

sit

hag

tô

lok

pcp

again east

‘the cup that is eastward (ii)’ On the contrary, cups i and iii would never be designated by reference to geography, but to the person they were obviously associated with and physically close to. In this case, the personal directionals were used, usually combining with a demonstrative: FIGURE 3. PERSONAL VS. GEOCENTRIC DIRECTIONALS: ONE TABLE, TWO SPEAKERS, FOUR CUPS

hay ‘landward’

I II III B

hôw ‘westward’

hag ‘eastward’

rel

sit

van anen

tô

lok

pcp

again thither dx:2

‘the cup that is toward you (iii)’ Here, the use of the geocentric strategy (…lok yow ‘the cup seaward’) would have been considered awkward or rude, as it would ignore the presence of the participants, despite their high saliency in the situation. This observation, which was made here on a very small scale, can also be made in larger contexts, as long as the participants are perceived as present in the situation. For example, on the large football ²eld of Lahlap village, let us imagine a player A telling his fellow B to send the ball to a third player C, who happens to be standing on the western side of the ²eld. In this case, because the participant C is both salient and pragmatically relevant, the personal strategy would be the norm: (29) a. Nêk so 2sg

prsp

kik

van hiy

Pêlêt!

kick

thither to

Fred

‘You should kick (the ball) to Fred!’ The use of the geocentric system would only be appropriate if A were asking B to send the ball not to someone in particular, but to a speci²c portion of space, irrespective of the presence of other participants there: (29) b. Nêk so 2sg

prsp

hÔw!

kik

lok

kick

again west

‘You should kick (the ball) westward!’ To sum up, whenever a direction can be represented by reference both to a participant and to a cardinal direction, the personal strategy (me ‘hither’/ van ‘thither’) will take priority over the geocentric one.11 We can infer from this a hierarchy of the form (a) > (c). 3.4.2 Personal strategy > Local strategy. A similar reasoning holds for the relation between (a) the personal strategy and (b) the local strategy. When both these coordinate sets are relevant, it appears once again that the personal set (a) will always take priority. Among other examples, this hierarchy was evidenced in a spontaneous situation we faced in the ²eld, once again at tea-time. In the preceding days, we had already heard people utter sentences like (30a), while pouring tea into a cup placed on the table: (30) a. Ni-ti art-tea

A

IV

art-cup

421

en,

nok sey

hÔw la-ba§kên

nônôm.

dx

1sg

down loc-cup

your

ao:pour

lit. ‘Let me pour some tea down in your cup.’ But the situation was utterly different when the drinker held his cup in his hands: his saliency in the context would then make him a natural reference point in order to establish the spatial vector associated with sey ‘pour’. In this case, (30a) would have sounded rude, and the only appropriate phrasing would make use of the personal strategy:

yow ‘seaward’ 11. Similar remarks are proposed by Hill (1997:123). See also Bowden (1992:123), “Given the need for a reference point, the most natural one for a speaker to adopt is the speaker himself/ herself.”

422

oceanic linguistics, vol. 42, no. 2 (30) b. Ni-ti art-tea

en,

nok sey

van la-ba§kên

nônôm.

dx

1sg

thither loc-cup

your

ao:pour

lit. ‘Let me pour some tea thither in your cup.’ It is therefore legitimate to posit a second hierarchy between two spatial strategies, of the form (a) > (b). Note that the same observation is also suggested by an example such as (12a,b). Privileging the personal coordinate set over the local one does not necessarily prevent the latter from featuring in the sentence: the direction in local terms can be encoded on the verb, or another morpheme of the clause, like the verb-modifying adjunct (see [1]): (31) Lep ao:take

bat

me

na-ta§

anen.

inward

hither

art-bag

dx:2

me!

ao:ascend

hither

‘Come up!’ 3.4.3 Local strategy > Geocentric strategy. Likewise, if a movement in space corresponds both to a local asymmetry and to a geocentric axis, the former will always have priority over the latter; in other words, there is a strong hierarchy of the form (b) > (c). Container perspective vs. geocentric system. Let’s consider the “container perspective” (in–out). If somebody is walking in a certain direction, without any local asymmetry perceptible, then the geocentric coordinates will be the default: the subject will be said to go eastward (hag), or westward (hôw), or seaward (yow), and so forth. But as soon as the motion can be related to a containing ²gure in a close situation (e.g., a house, a covered area), then this geocentric system will be overruled by the local system (in–out), regardless of the direction that is followed in cardinal terms. (33) Tatal ao:walk

hag nen, … east

3du

ao:exit outward

out

loc-garden

kaskas

vitwag.

³ower

one

… they came out into a ³ower garden.’ [containing ²gure → asymmetry → local strategy] Vertical axis vs. geocentric system. The same applies for the vertical axis (up– down). Suppose someone is walking from the shore landward, toward the heights of the island: this motion could potentially be represented either using the local asymmetry system, that is, the vertical axis, or the geocentric system, that is, the land/sea axis. Indeed, both systems are possible here, according to the perception one has of the motion.

ni-hêw

têqêl

small ao-descend

yow

downward seaward

ale. on.shore

‘The little boy walked down to the beach.’ [lit. descended seaward] Each situation imposes its own geometry. Finally, it is important to note that the hierarchy Local > Geocentric has nothing to do with either the nature of the objects located or their canonical position in space. On a small scale, both coordinate sets are equally common; the choice of the proper one will depend on which is more relevant for the encoding of a given vector, based on the speci²c geometry of the current situation. This strict situational dependence became obvious one day as someone was looking at a photo album where each page had two pictures, one above the other. As long as the album was held more or less vertically, the only relevant strategy employed to designate either photo was the vertical axis, regardless of the geographic setting: (35) a. no-totgal art-picture

mey lok rel

hag alge

again up

above

‘the picture up above’ But as soon as the album was put horizontally on somebody’s lap or on a table, then reference to a local asymmetry (speci²cally the vertical axis) became impossible. That was when the geocentric system had to be activated: art-picture

‘As they were walking eastward, [no local asymmetry → geocentric strategy] … tô kôyô sey lô yow lê-tqê then

art-boy

(35) b. no-totgal

dx:2

423

If the slope is particularly steep, then the physical feeling of going upward will be perceptually salient over the geocentric one, and the local system will be preferred (van hag ‘go up’). Conversely, if the slope is gentle, as is the case in most parts of the island, then the motion will be conceived as essentially horizontal; the geocentric coordinates will then provide the only strategy available for linguistic encoding (van hay ‘go inland’).12 In a way reminiscent of (31)–(32) above, the selection of a geocentric directional does not preclude the use of the vertical axis elsewhere in the sentence. It is therefore common to hear combinations of two distinct reference strategies in the same clause, following the pattern: local coordinates on the verb and/or the adjunct, geocentric coordinates on the directional: (34) Nô-lômgep su

‘Bring that bag in (toward me).’ Thus, in cases where English says come up (‘personal’ + ‘local’), Mwotlap uses the reverse encoding strategy, literally saying ascend hither [compare with (6)]: (32) Vêykal

space directionals in mwotlap

mey lok rel

yow

again seaward

‘the picture seaward’ Crucially, one will notice that, when the album is horizontal, European languages would continue to refer to the pictures as being respectively ‘above’ and ‘below’, virtually referring to the canonical position of the book in the reader’s hands, and/ or to the typical way of reading (see Levinson 1996b:373). On the contrary, spatial coordinates in Mwotlap are calculated with reference to the current position of the object in the speci²c event situation, without any mental projection into its usual or intended use: this is made clear in (35b). 12. One will notice that this nuance is possible in Mwotlap but irrelevant in many Oceanic languages that code ‘inland’ precisely in the same way as ‘upward’—e.g., New Caledonian languages (Ozanne-Rivierre 1997) or North-East Ambae (Hyslop 2001).

424

oceanic linguistics, vol. 42, no. 2

As far as our discussion is concerned, this means that the priority rule Local > Geocentric only holds if a local asymmetry (in/out or up/down) can actually be perceived in the geometry of the current situation. 3.4.4 Synthesis: the Coordinate-set Hierarchy Hypothesis. We have successively demonstrated three binary hierarchies: ²rst (a) > (c), then (a) > (b), and ²nally (b) > (c). It is not dif²cult to infer from these a ternary relation, of the form (a) > (b) > (c). This corresponds to the Coordinate-set Hierarchy Hypothesis: Personal strategy > Local strategy > Geocentric strategy According to this hypothesis, when Mwotlap speakers need to vectorize an event in space, they mentally scan through three sets of coordinates, following a strict order of priorities, until they identify the most appropriate directional. These mental operations are synthesized in ²gure 4. These observations show that the geocentric system is only used as a default, that is, when other strategies are not available. This point is instructive in two respects. On the one hand, it provides as explanation as to why geocentric directionals—as part of the default space-encoding strategy—are so pervasive in Mwotlap speech. But on the other hand, it suggests that the importance of geocentric reference (which attracts the attention of foreigners because it seems unusual to them) should somehow be relativized. Considered from within the mechanics of the system, it is simply one of several strategies and appears to be the one with the lowest weight and saliency. The ²rst part of this paper has detailed the three coordinate sets used in Mwotlap space reference, and the hierarchical relationship that holds between them. Yet, although the information we have given on directionals was suf²cient for this initial overview of the space system, a more detailed description is now required in order to fully understand the ins and outs of Mwotlap’s geographically based reference system.

FIGURE 4. THE ARCHITECTURE OF SPACE: HOW TO SELECT THE PROPER DIRECTIONAL IN MWOTLAP

3 salient participant

no salient participant

3 personal strategy

local asymmetry

no local asymmetry

local strategy

geocentric strategy

3

3

3

to deictic center

not to deictic center

container

verticality

⊥ shore

// shore

 

 

 

 

 

 

me ‘hither’

van ‘thither’

hay – yow ‘in’ – ‘out’

hag – hôw hay – yow hag – hôw ‘up’ – ‘down’ ‘land’ – ‘sea’ ‘east’ – ‘west’

space directionals in mwotlap

425

4. THE GEOCENTRIC SYSTEM: A DOUBLE METAPHOR. Until now, all that has been said of the four geocentric directionals concerns their synchronic use in a speci²c system of spatial coordinates, distinct from other strategies available to the speaker. In this framework, the only relevant explanation has consisted of describing how the system divides horizontal space into four equal, symmetrical quadrants (3.3). Now, a second step in the observation should try and account for the way these four directions are lexi²ed, and see how this particular system may have arisen. Indeed, we still have to explain the exact formal parallelism between what we have called the local and the geocentric directionals. This is given in table 1. Our concern now will be to understand the semantic motivations of such a parallelism. Incidentally, this new approach will trigger a small change in our word-toword principles: whereas the preceding section carefully distinguished between the local and the geocentric translations for a single morpheme (e.g., hag glossed as ‘up’ vs. ‘east’), from now on the directionals will systematically receive their gloss in local terms (e.g., hag always glossed as ‘up’), whatever their actual reading. 4.1 THE ISLAND AS A CONTAINER. The ²rst case we will examine draws a relation between the local directions ‘in’/‘out’ and the geocentric ones ‘landward’/ ‘seaward’. The reason for this formal similarity is not dif²cult to ²gure out: the island is perceived as a container, the outside of which corresponds to the surrounding sea. Walking from one spot on the island toward the beach is equivalent to going ‘outward’ (yow), and conversely any motion toward the interior of the island (notice the same metaphor in English), even for a very short distance, is thought of as ‘inward’ (hay). The metaphor suggested by the directionals hay/yow is commonly reinforced by other words of the sentence, like the verb or the adjunct: (36) a. Ni-siok so art-canoe prsp

ni-hayveg

bat

hay le-pnô.

ao-enter

inward

in

loc-island

‘The canoe was heading toward the island.’ [lit. entering inward in the island] But despite its intuitive appeal, this metaphor “inland = in” is not to be taken for granted. First, it should be noted that apart from Mwotlap—plus a couple of neighboring languages—there aren’t many Oceanic languages that have the same image; most of them either use speci²c words for ‘inland’ vs. ‘sea’, or employ the vertical axis (‘up’–‘down’) for this purpose (see footnote 12). And, in fact, the latter possibility is not unknown in Mwotlap: even if it is not done with directionals, resorting to the vertical axis to encode the land/sea contrast is at least commonly done on the TABLE 1. LOCAL AND GEOCENTRIC READINGS OF FOUR SPACE DIRECTIONALS directional

local reading

geocentric reading

hay

‘in’

‘landward’

yow

‘out’

‘seaward’

hag

‘up’

‘east’ (?)

hôw

‘down’

‘west’ (?)

426

oceanic linguistics, vol. 42, no. 2

verb or the adjunct—compare with (34) on land. This is so even when no vertical motion is involved: observe how the next sentence, still representing a canoe at sea, suggests two simultaneous equations (“inland = up” and “inland = in”): (36) b. Ni-siok so art-canoe prsp

ni-vêykal

hay alge.

ao-ascend

in

above

‘The canoe was heading toward the island.’ [lit. ascending in above] Moreover, other metaphors appear to even contradict the equation “inland = in.” The technical register of seafaring, despite using directionals normally (hay ‘toward the island’ ≠ yow ‘toward the open sea’), also employs locative adverbs exactly in the opposite way: alon [lit. ‘inside’] is ‘in the open sea’, whereas aslil [lit. ‘outside’, see (23)] means ‘on the shore’. Example (36c) illustrates this stunning contradiction between two distinct images, hay suggesting the equation “inland = in,” whereas aslil points to the opposite metaphor “ocean = in”: (36) c. Ni-siok so art-canoe prsp

ni-hayveg

bat

hay aslil.

ao-enter

inward

in

outside

‘The canoe was heading ashore.’ [lit. entering in outside] Yet, even if the surrounding verbs or adverbs can indeed show different strategies, the two directionals hay and yow are constant in identifying the island as a containing ²gure. Consequently, the land/sea axis, although belonging to the geocentric coordinate set, can ultimately be explained as a mere extension of the local system on the scale of a whole island. In order to characterize a horizontal motion perpendicular to the shore (e.g., walking across the village clearing, or pushing a cup on the table), we can imagine a speaker of Mwotlap searching ²rst for a local asymmetry (²gure 4); if none were to be found in the close environment, this speaker would “stand back”, so to speak, and ultimately look for an asymmetry on a wider scale. This is how a small move on the horizontal plane, which at ²rst glance looks impossible to describe in local terms (i.e., being neither inward nor outward, neither upward nor downward), can nonetheless be assigned to some asymmetry, provided the whole shape of the island is taken into account. Nonetheless, although this description ultimately merges the local and the geocentric systems (“inland = in”), it is not necessarily true that the comparison is consciously activated every time the land/sea axis is used. It is probably more realistic to conceive this semantic extension as a historical event, a linguistic innovation that happened at some date in the past.13 For the modern speaker, this metaphor is not necessarily obvious, and at least seems to be acquired by children much later than the geocentric system itself. 4.2 THE UP–DOWN AXIS ON THE HORIZONTAL PLANE. The mechanics of the up-down axis are even more opaque to the majority of speakers. Very few people 13. It is dif²cult to propose a date for this innovation. But as far as we know, the metaphor “inland = in” is not attested anywhere in Vanuatu other than in Mwotlap, and in Mwesen, Vurës, and Vera’a on neighboring Vanua-lava as well (pers. data). Outside Vanuatu, the same pattern is also witnessed in two North New Guinea languages around the Huon Peninsula, Jabêm (Streicher 1982:151) and Mangap-Mbula (Bugenhagen 1995:378). A deeper study of Oceanic languages should help improve our knowledge on such topics; see François (forthcoming b).

space directionals in mwotlap

427

on Mwotlap are able to explain why east is ‘up’ (hag), and west is ‘down’ (hôw); nothing justi²es this parallelism in the geography of the island, as if it were higher in its eastern part.14 Other motivations remain to be explored, such as one that would derive this up– down contrast from the path of the sun or from the direction of prevailing winds. Our demonstration will eventually prove the latter to be the correct explanation. Incidentally, note that we shall regularly refer to this up–down axis as “the cardinal axis” of the system. As we have explained in 3.3.1, such a terminological choice is justi²ed by the relative ²xedness of its orientation in cardinal terms, regardless of one’s position on an island—which is not true, obviously, for the land/sea contrast. Nevertheless, this section will also give us an opportunity to re²ne the description of this “cardinal” axis, and realize that it is more complex than a simple ‘east’–‘west’ direction. 4.2.1 The path-of-the-sun hypothesis. A probable explanation, which is sometimes proposed by native speakers themselves, would make a relation with the path of the sun. Following a conceivable—though unclear—metaphor, the place where the sun rises would be understood as being ‘up’, whereas the sunset would be coded as ‘down’. This hypothesis could be con²rmed by the usual association of hag ‘up’ with the morning or sunrise, and hôw ‘down’ with the evening or sunset (but see footnote 5): (37) Tô then

mahê

ni-mtap

hag.

place

AO-morning

up

‘Then dawn began to rise.’ [lit. ‘It was morning up.’] (38) Tô mahê ni-qô§ hôw. then

place

AO-night

down

‘Then night fell.’ [lit. ‘It was night down.’] Moreover, certain Oceanic languages whose system is similar to that of Mwotlap are described along these lines. Longgu (Hill 1997), a language spoken on Guadalcanal, has a cardinal axis running from wnw to ese, that is, roughly from ‘west’ (toli, originally ‘down’) to ‘east’ (ala’a, originally ‘up’). Following the suggestion of her informants, the author proposes that this axis is “derived from the rising and the setting of the sun” (Hill 1997:106)—see the discussion in François (forthcoming b). Indeed, this was initially the interpretation we had formed to account for the cardinal axis of Mwotlap. But later on, several elements made us challenge our own hypothesis. First of all, we were not fully satis²ed with the idea that speakers of a language could spontaneously say I am going up when what was meant would be ‘I am going toward the place where the sun rises’. A second thought was that if the path of the sun were so salient to Mwotlap speakers, then it should have been used constantly in all landscapes, both on Mwotlap and on other islands. But traveling around Vanuatu with Mwotlavians helped us realize that this was not so. 14. Such orographic explanations were proposed for other languages, whose system resembles super²cially that of Mwotlap with up = east and down = west. For example, in Tzotzil Maya, the east/west axis “roughly overlaps with the inclined topography of the region, for this reason E[ast] corresponds to the Highlands and W[est] to the Lowlands” (de León 1994, cited by Senft 1997:17; Palmer 2002:126). See also Ozanne-Rivierre (forthcoming) for a similar presentation of Iaai (Loyalty Islands), and François (forthcoming b) for the relevant discussion.

428

oceanic linguistics, vol. 42, no. 2

4.2.2 Mwotlap outside Mwotlap. In Port Vila, the capital of Vanuatu where many Mwotlap speakers live, the rising of the sun does not take place in the hag direction, but hay ‘inland’:

space directionals in mwotlap

429

‘In Vila, the sun rises toward the inland side (hay), not the hag-side.’ Indeed, in the context of Vila, the geocentric axes correspond to totally different directions from those used on the island of Mwotlap. The land/sea axis (hay-yow), which by de²nition is orthogonal to the shore, is physically oriented from east to west; and the up-down axis, which is necessarily perpendicular to the latter, runs from due north (hôw ‘down’) to due south (hag ‘up’). In comparison with the system we have seen at work so far on the island FIGURE 5. MWOTLAP GEOCENTRIC DIRECTIONALS IN THE CAPITAL of Mwotlap, the reason for rotating PORT VILA the whole system this way is obviously that the main shore in Vila is N oriented north to south. Before going any further in the investigation, these hôw ²rst observations already provide evi‘down’ dence for some interesting conclusions. When speakers of Mwotlap hay ²nd themselves in a new landscape, ‘in’ the axis that they establish ²rst is the yow ‘out’ land/sea axis (coded in-out), probably because the shore and the declivity of hag the ground are perceptually the most ‘up’ salient features of the landscape (Palmer 2002:131). Once the latter axis has been established, a second Port Vila axis is drawn, orthogonal to it, and thus necessarily parallel to the shore. This logical hierarchy is evidenced by the fact that the land/sea axis always determines the direction of the second axis, never the other way around.15 Now, if Mwotlap behaved here like several Oceanic languages that leave this “traverse axis” unspeci²ed (Palmer 2002; François forthcoming b), there would be no need for further discussion, because the second axis would simply be de²ned by the orientation of the shore. But the system of Mwotlap additionally requires the speaker to orient it along a “conceptual slope” (Levinson 1996b:371) oriented updown. In this situation, how do speakers calculate the orientation of this cross axis, and assign, say, the up-direction (hag) to the proper side of the landscape?

To be precise, the speakers themselves do not bother with this question, as long as they remain on the island where they were born and raised; it only becomes relevant in the particular situation when one reaches unfamiliar landscapes and has to adapt to the change of environment. This is why the best way to understand the Mwotlap system involves observing how Mwotlap speakers, leaving the shores of their own island, manage to ²nd their bearings in other landscapes. The example of Vila, which we FIGURE 6. HOW MWOTLAP had noticed by chance, gave us the GEOCENTRIC DIRECTIONAL idea of extending the inquiry to HAG ‘UP’ IS EMPLOYED ON other islands of Vanuatu. When we OTHER ISLANDS OF VANUATU could not visit an island ourselves, we looked for people who were familiar with it. Of course, the test didn’t involve asking people to use maps themselves, which would have proved dif²cult for them and led to dubious results. Instead, for each area covered, several individuals were asked whether going from a place X to a place Y (e.g., two familiar villages) would mean going hag ‘up’ or hôw ‘down’. The results were generally consistent, and when they were not, a brief discussion would help select the agreed-upon answer. Incidentally, the habit of using geocentric directionals even when referring to imaginary or remote settings is a mental activity Mwotlap people are familiar with, N especially through the tradition of story telling. Each time a reliable answer was achieved, we could draw arrows on our maps, and thus research empirically the nature of the geocentric up-down axis in Mwotlap. The results of this investigation are presented in ²gure 6, where each arrow points to the direction called hag ‘up’. As the ²gure shows, the directional hag ‘up’ is far from pointing constantly toward the rising of the sun. According to the orientation of the shore, the down → up axis may correspond to several different directions:

15. This hierarchy is the reverse of the one assumed by Blust for western Malayo-Polynesian languages when he says: “Within the monsoon region, the land-sea axis is restricted to cardinal north and south (since cardinal east-west is pre-empted by the monsoon terms), while outside the monsoon region this need not be the case” (Blust 1997:48; emphasis added).

• { W → E }, as on both sides of Mwotlap, on southern Ambae, southern Santo, southern Malekula; • { N → S }, as on both sides of Vanua-lava, Gaua, Santo, Maewo, Pentecost, Efate (and also in the town of Port Vila: ²gure 5);

(39) Vila, na-lo V.

art-sun

ni-hatig lok

hay,

ao-get.up again in/inland

lok

hag

again up/east?

te. neg

430

oceanic linguistics, vol. 42, no. 2

• { NW → SE }, as in the Torres, on both sides of Malekula, on eastern Ambrym; • { NE → SW }, as on the western side of Ambrym, on the eastern and western sides of Ambae. Despite the apparent inconsistency between all these directions, it remains possible to con³ate them into a single, “mean” vector, which would run from northwest to southeast. And indeed, it appears that the direction hag is never pointed north, nor due west. Rather, all the attested vectors ²t within the limits of a single (virtual) semicircle that is the southeastern half of space. Any geocentric direction belonging to this conceptual half will be encoded as hag ‘up’ in Mwotlap, and conversely, any motion directed toward north and/or west will be encoded as hôw ‘down’. The geometry of the Mwotlap cardinal axis is represented in ²gure 7. The main arrow, representing due southeast, could be named the “prototypic value” of the geocentric directional hag: it is the idealized average of all the empirically attested hag directions. But the latter can designate directions that are in fact remote from this prototype, even if the difference is never greater than 90 degrees. Remarkably, this is true about the island of Mwotlap itself. Far from providing hag with its prototypic value, the cardinal axis there is rotated to the extreme limits of the semicircle—up to 80 degrees counterclockwise—so as to ²t with the shape of the landscape. This is why the ²rst description we gave here of the geocentric directionals hag-hôw as meaning respectively ‘east’ and ‘west’ was in fact only true in the context of Mwotlap, and false elsewhere. Despite being apparently inaccurate, our choice was justi²ed by the fact that the majority of speakers who remain in their island have no need for assigning any other meaning to these two directionals. But there is an even more instructive conclusion to draw here. Knowing that the language of Mwotlap has been spoken almost exclusively on the island of the same name for several centuries, one would have expected the speakers of Mwotlap, after many generations of learning to identify ‘up’ with ‘[north]east’, to ²nally reanalyze this as the typical meaning of hag, before adapting it to new places. On the contrary, the use of the geocentric system in their native island has continued until today to correspond to a marginal reading of the nw-se cardinal axis (²gure 7). The latter system, which arguably was historically prior to its modern Mwotlap version, has thus been preserved across generations. To account for such a paradoxical conservation, there must have been a speci²c speech context in which Mwotlap speakers would regularly bring back the cardinal system to their attention and memory. This context was the art of seafaring. 4.2.3 Geocentric reference on the navigational scale. Directionals at sea. The previous section examined how the cardinal up–down axis was regularly projected onto the terrestrial shape of other islands, but nothing was said of its use at sea. Although recent generations of Mwotlap have abandoned the art of sailing, they are still used to paddling along the coast with small individual canoes, and also to visiting the neighboring islands with modern motor boats—to say nothing of Chinese cargo vessels. These journeys on the sea are still an occasion for employing the geocentric system of reference, but in a context that may be called “navigational scale” (Palmer 2002:131).

space directionals in mwotlap

431

The reader will remember from 3.3.1 that the land/sea axis extends far out to sea. When a boat is coming closer to a given island, it is said to go hay ‘in’ (36a–c); conversely, paddling away from it is expressed with yow ‘out’. This use of hay and yow at sea is orthogonal to the shore under consideration, following exactly the same pattern as on dry land. Likewise, as long as the island is in sight, the cardinal up–down axis will be parallel to that same shore, and will vary according to its shape. For example, people paddling close to the coast of Mwotlap continue to mean ‘westward (along the coast)’ when using the directional hôw, as they would do on land. But things become different when no island can be seen, or when the presence of an island is pragmatically irrelevant. In this situation, the land–sea axis (hay–yow) naturally disappears, and the only axis to be activated is the up–down one (hag–hôw), dividing the whole maritime space into two halves instead of four quarters. And because no shoreline imposes its tortuous shape, the direction of the up direction becomes crystal clear: it points due southeast, strongly con²rming the hypothesis of ²gure 7. From one island to another. The same rules apply when somebody, located on one island, wants to refer to another island. Indeed, although it is grammatically possible to refer to a place only by its name, as in (40), the presence of a directional will be almost systematic, as in (40′). (40) Nok so 1sg

prsp

hohole Santo. speak:dup S.

‘I want to phone (somebody in) Santo.’ (40’) Nok so hohole hag Santo. 1sg

prsp

speak:dup up

S.

‘I want to phone (somebody in) Santo up there.’ [uttered on Mwotlap I.]

FIGURE 7. THE CARDINAL (UP-DOWN) AXIS IN MWOTLAP: ALL ATTESTED UP-DIRECTIONS BELONG TO THE SOUTHEASTERN HALF OF SPACE

hôw ‘down’ on Mwotlap

(on Santo)

(on Malekula)

hag ‘up’

(on Ambae) (in Vila)

432

oceanic linguistics, vol. 42, no. 2

Now, the choice of the proper directional, which we found dif²cult to make when we were in the ²eld, is in fact straightforward. Hag ‘up’ is associated with all islands located southeast of Mwotlap: Mota, Gaua, Santo, Ambae, Maewo, Efate (and the capital Port Vila), Tanna…; it is also used for all foreign countries (New Caledonia, Australia, France, the USA), probably because one has to go ²rst to the capital before ³ying abroad. Conversely, the directional hôw ‘down’ is associated with islands northwest of Mwotlap: Ureparapara, the Torres Islands; and the Solomons, despite being a foreign country, are also designated as hôw, because long-standing trade relations between the Banks and the Santa Cruz archipelagoes have led people to know the exact location of this country.16 Of course, when the situation is reversed, the directional just needs to be reversed: that is, if Vila is up from Mwotlap, conversely Mwotlap is down from Vila, and so on. Taking Mwotlap Island as the origin, ²gure 8 shows how the navigational scale of this language divides the whole world, so to speak, into two halves. The special case of visible islands. As the ²gure suggests, the language of Mwotlap only seems to have met a dif²culty when trying to assign a proper directional to the island of Vanua-lava. Indeed, this huge island is located exactly southwest of Mwotlap, making it impossible to refer to it either as being up (hag) or down (hôw).17 Exceptionally, the directional used in this case is hay ‘inland’; and symmetrically, someone located on Vanua-lava will designate Mwotlap as being yow ‘seaward’. The reason for having chosen hay certainly has to do with the high volcano of Vanua-lava, which dominates the horizon when seen from Mwotlap. Indeed, the land/ sea axis is sometimes used between two islands A and B, provided they are visible from each other. If A is lower than B, then people from A will refer to B as being hay ‘inland’, as if they were in the position of a ship approaching land. Conversely, people from B will have the feeling of pointing yow ‘out to sea’ when considering a lower island. Remarkably, this rule does not depend on the relative size of A and B, but only on their relative height: thus the inhabitants of Mwotlap, who predominantly live in low coastal villages, designate as hay both the high and huge island of Vanua-lava to their southwest, and the high and small islet of Aya to their immediate southeast (²gure 2). But apart from this exceptional case of a few islands that are visible from each other, all other cases make regular use of the global cardinal (up–down) axis. 4.2.4 Sailing into the wind. One question still remains to be answered. What does this southeast direction stand for? And why is it lexi²ed as ‘up’? Southeast de²nitely has nothing to do with the sun, nor does it correspond to any salient astral phenomenon. However, it does re³ect a natural element, well known to all the sailors of the South Paci²c: the wind—more precisely the trade winds, which 16. Hyslop (2001:217) reports that in the language of North-East Ambae, all foreign countries are designated as ‘up’, including the Solomons. This suggests that the location of this country to the northwest of Vanuatu is not as salient for Ambae people as it is for the populations in the Banks. 17. Most remarkably, the same phenomenon is reported for North-East Ambae (Hyslop 2001:216). The world is divided in two, the southeastern half being ‘up’ (hage) and the northwestern being ‘down’ (hivo); but because Malekula lies precisely across the way, it can be characterized neither as ‘up’ nor as ‘down’. Instead, the language uses a neutral direction, vano. Our map is inspired by hers.

space directionals in mwotlap

433

in that part of the world blow from southeast toward the equator. Because, at least until recently, the people of Mwotlap used to sail, the direction of the prevailing winds continue to play an important role in their system of spatial reference: sailors at sea don’t have many clues other than the wind, when trying to orient themselves. Some form of seafaring astronomy is sometimes reported for these Oceanic populations (Osmond 2000), but it has been lost for several generations in Mwotlap. Incidentally, the names of the four principal Mwotlap winds are: Le§yeqo ‘se wind’, Wôvet ‘ne wind’, Togle ‘nw wind’, Kêyêbê ‘sw wind’. As for the use of the two local directionals hag ‘up’ and hôw ‘down’, it probably results from a metaphor, the same one that motivates the pair of English directionals upwind vs. downwind. A boat heading into the wind meets the same kind of physical resistance as a man walking up a steep slope, and conversely, to sail with the wind astern appears to be as easy and swift as for somebody to run down a hill (Françoise Ozanne-Rivierre, pers. comm.). If this interpretation is true, then the use of this wind-based axis on dry land is obviously secondary, and results from the mapping on land of a referential system which was elaborated essentially at sea, by a seafaring culture (see François, forthcoming b). FIGURE 8. THE WORLD IS DIVIDED IN TWO HALVES, ONE UP AND ONE DOWN; A THIRD DIRECTIONAL IS USED IN THE SPECIAL CASE OF VANUA-LAVA

Ê hay hôw ‘down’

Ç

hag ‘up’

434

oceanic linguistics, vol. 42, no. 2

The trade-wind hypothesis has been proposed by several scholars to account for similar facts in the languages of the Paci²c: among others, Lavondès (1983) for Marquesan; Ozanne-Rivierre (1997:85) for several languages of Polynesia and of New Caledonia; Hyslop (2001:216) for North-East Ambae. But even if their explanations did, of course, help us eventually solve the last step of our reasoning, our principle has been not to take any explanation for granted before trying to disentangle our ²eld data. This conclusion was thus arrived at independently, following an essentially empirical methodology. We could only ²nd a couple of elderly people in Mwotlap who clearly con²rmed that the up-down contrast was originally in relation to the wind. Though, even if the metaphor involved in the up-down axis is opaque to contemporary speakers, it is still common to reinforce the directional by a verb and/or an adjunct and/or an adverb of the same basic (vertical) meaning: (41) Dôyô

so

1incl:du prsp

vêykal

hag alge.

ascend

up

above

‘We should go (south-)eastward.’ [lit. we should ascend up above] (42) Nêk tê-hêw têqêl hÔw ½otlap §êh? 2sg

fut-descend

downward down M.

when

‘When will you go down to Mwotlap?’ [uttered in Santo] The apparent up-down movement in such sentences is purely metaphorical, and does not correspond to anything on the vertical axis. 4.2.5 Summary. We have demonstrated that the geocentric axis coded hôw-hag, despite running from (south)west to (north)east on the island of Mwotlap, corresponds, in fact, to a global axis oriented from northwest to southeast. Its overall direction, and its lexical expression as up–down as well, are historically motivated by the path of the trade winds. This axis can be activated in two different ways. When the speaker is at sea, or refers to long-distance relations between islands, then the cardinal axis regularly points southeast, dividing space into two equal halves, one ‘down’ and one ‘up’ (²gure 8). But when the speaker is on dry land, or on a boat close to an island, then the cardinal axis combines with the land/sea axis, de²ning four equal quarters. If the system has to be applied to a novel landscape, then the land/sea axis is always assigned in priority, whereas the up/down axis is secondarily mapped onto the contours of the island. This adaptive process may involve pivoting the cardinal up away from the actual southeast, though never more than 90 degrees on either side. Once again, this semantic parallelism illustrates how the local coordinate set—in this case the vertical axis—has been extended so as to encode a set of coordinates belonging to the horizontal plane. But if the use of in–out for the land/sea axis could be seen simply as the widening in space of the “container perspective” (4.1), the example of up–down is somewhat different, because it involves an obscure metaphor that is no longer accessible to the average speaker of Mwotlap. Consequently, even after elucidating the double metaphor at the source of the four geocentric directionals, it is still necessary to distinguish structurally between what we have called the local and the geocentric coordinate sets—although they make use of exactly the same morphemes. Table 2 summarizes the mechanism of geocentric reference in Mwotlap.

space directionals in mwotlap

435

5. CONCLUSION. The linguistic act of referring to space consists in looking for asymmetries, even when, at ²rst sight, none are perceptible. In Mwotlap, the use of personal and deictic coordinates is far from being unknown, and can even be said to receive priority over other coordinates. But often the speaker ²nds it impossible, or pragmatically irrelevant, to encode a direction by referring to the event participants, or to a local situation; in this case, the default strategy resorts to a set of four horizontal quadrants, whose arrangement is recalculated in each new setting. Ultimately, this four-term system can be shown to be motivated by the structure of the environment, of which certain features appear to be—or to have been in the past—culturally signi²cant, and hence cognitively salient. The asymmetry of the land/sea contrast is a daily reality for these populations, who dwell mainly on coasts, and whose diet combines root crops and seafood. And the art of navigation, so deeply entrenched in the history of Oceanic cultures, has made it possible to organize space along another asymmetry, namely the path of the strongest winds. The next step in this research would entail comparing the Mwotlap system with that of other Oceanic languages that have been described to date, with the aim to formulate hypotheses on the historical development of these geocentric directionals— see François (forthcoming b). And of course, the more languages are described in the future, the better we will understand these intricate issues.

TABLE 2. THE FOUR GEOCENTRIC DIRECTIONALS OF MWOTLAP: SUMMARY

hay – yow

hag – hôw

Local coordinate set

container perspective ‘in’ – ‘out’

vertical axis ‘up’ – ‘down’

Geocentric coordinate set

‘inland’ – ‘out to sea’

‘upwind’ – ‘downwind’

island = container

facing the wind = climbing up a slope

de²ne two quadrants orthogonal to shoreline:

de²ne two quadrants parallel to shoreline: up ≈ toward SE down ≈ toward NW

in = toward (middle of) island out = toward (deep) sea

[precise orientation may be up to 90° away from cardinal SE/NW, depending on the shoreline]

underlying metaphor ON LAND

(whatever the scale) or AT SEA

close to/with reference to an island AT SEA

with no island in sight or in mind

—

divide space in two halves: up = toward SE down = toward NW

436

oceanic linguistics, vol. 42, no. 2 REFERENCES

Adelaar, Sander. 1997. An exploration of directional systems in west Indonesia and Madagascar. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 53–81. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Bennardo, Giovanni, ed. 2002. Representing space in Oceania: Culture in language and mind. No. 523. Canberra: Paci²c Linguistics. Blust, Robert. 1997. Semantic change and the conceptualization of spatial relationships in Austronesian languages. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 39–51. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Bowden, John. 1992. Behind the preposition: Grammaticalisation of locatives in Oceanic languages. Series B-107. Canberra: Paci²c Linguistics. Bugenhagen, Robert. 1995. A grammar of Mangap-Mbula: An Austronesian language of Papua New Guinea. Series C-101. Canberra: Paci²c Linguistics. Codrington, Rev. R. H. 1885. The Melanesian languages. Oxford: Clarendon Press. Codrington, Rev. R. H., and Jim Palmer. 1896. A dictionary of the language of Mota, Sugarloaf Island, Banks Islands. London: Society for Promoting Christian Knowledge. Crowley, Terry. 2002. Mwotlap. In The Oceanic languages, ed. by John Lynch, Malcolm Ross, and Terry Crowley, 587–598. London: Curzon Press. Foley, William. 1997. Anthropological linguistics: An introduction. Language in Society. Oxford: Blackwell. François, Alexandre. 2001. Contraintes de structures et liberté dans la construction du discours: Une description du mwotlap, langue océanienne du Vanuatu. Doctoral dissertation, Université Paris-IV, Sorbonne. 1078 pp. ———. 2003. La sémantique du prédicat en mwotlap (Vanuatu). Collection Linguistique, Société de Linguistique de Paris, vol. 84. Paris, Louvain: Peeters. xx + 388 pp. ———. Forthcoming a. Desperately seeking benefactives in Mwotlap. In Coding for benefactives in Oceanic languages, ed. by Anna Margetts. ———. Forthcoming b. Reconstructing the geocentric system of Proto-Oceanic. ———. In progress. Dictionnaire encyclopédique mwotlap. Computer ²les. Paris: LACITO. Haviland, John. 1993. Anchoring, iconicity, and orientation in Guugu Yimithirr pointing gestures. Journal of Linguistic Anthropology 3(1):3–45. Hill, Deborah. 1997. Finding your way in Longgu: Geographical reference in a Solomon Islands language. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 101–126. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Hyslop, Catriona. 2001. The Lolovoli dialect of the North-East Ambae language, Vanuatu. No. 515. Canberra: Paci²c Linguistics. ———. 2002. Hiding behind trees on Ambae: Spatial reference in an Oceanic language of Vanuatu. In Representing space in Oceania: Culture in language and mind, ed. by Giovanni Bennardo, 47–76. No. 523. Canberra: Paci²c Linguistics. Keesing, Roger. 1997. Constructing space in Kwaio (Solomon Islands). In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 127–141. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Lavondès, Henri. 1983. Le vocabulaire marquisien de l’orientation dans l’espace. L’Ethnographie 79(1):35–42. de León, Lourdes. 1994. Explorations in the acquisition of geocentric location by Tzotzil children. Linguistics 32:857–884.

space directionals in mwotlap

437

Levinson, Stephen. 1992. Language and cognition: The cognitive consequences of spatial description in Guugu Yimithirr. Working paper no. 13: Cognitive Anthropology Research Group, Max Planck Institute for Psycholinguistics. ———. 1996 a. Frames of reference and Molyneux’s question: Crosslinguistic evidence. In Language and space, ed. by P. Bloom, M. Peterson, L. Nadel, and M. Garrett, pp.109–170. Cambridge, Mass.: The MIT Press. ———. 1996 b. Language and space. Annual Review of Anthropology 25:353–382. Lichtenberk, Frantisek. 1985. Syntactic-category change in Oceanic languages. Oceanic Linguistics 24:1–84. Osmond, Meredith. 2000. Star, wind, and wave: Searching for early Oceanic navigation terms. In SICOL: Proceedings of the Second International Conference on Oceanic Linguistics, vol.2, Historical and descriptive studies, ed. by Bill Palmer and Paul Geraghty, 3–35. Canberra: Paci²c Linguistics. Ozanne-Rivierre, Françoise. 1997. Spatial reference in New Caledonian languages. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 84–100. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. ———. Forthcoming. Spatial deixis in Iaai (Loyalty Islands). In Deixis and demonstratives in Oceanic Languages, ed. by Gunter Senft. Canberra: Paci²c Linguistics. Palmer, Bill. 2002. Absolute spatial reference and the grammaticalisation of perceptually salient phenomena. In Representing space in Oceania: Culture in language and mind, ed. by Giovanni Bennardo, 107–157. No. 523. Canberra: Paci²c Linguistics. Ross, Malcolm. Forthcoming. The grammaticisation of directional verbs in Oceanic languages. In Complex predicates in Oceanic languages: Studies in the dynamics of boundedness and compacity, ed. by Isabelle Bril and Françoise Ozanne-Rivierre. Empirical Approaches to Language Typology. Berlin: Mouton de Gruyter. Senft, Gunter. 1997. Introduction. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 1–38. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Streicher, J. F. 1982. Jabêm–English dictionary. Series C-68. Canberra: Paci²c Linguistics. Tryon, Darrell. 1976. New Hebrides languages: An internal classi²cation. Series C-50. Canberra: Paci²c Linguistics. Wilkins, David, and Deborah Hill. 1995. When go means come. Cognitive Linguistics 6:209–259.

LACITO-CNRS 7, rue Guy Môquet 94801 Villejuif FRANCE [email protected]

La réduplication en mwotlap : Les paradoxes du fractionnement Alexandre François*

INTRODUCTION La plupart des langues du monde accordent une signification linguistique au phénomène de la répétition. Répéter tout un énoncé s'interprétera par exemple comme la marque d'une émotion (Que d'eau ! Que d'eau !) ; la reprise d'un prédicat statique exprimera souvent une intensité qualitative (un gros gros chagrin), alors que celle d'un prédicat dynamique exprimera plutôt l'accumulation quantitative, la durée (Elle a parlé, parlé, parlé), et ainsi de suite. Certes, ces valeurs sémantiques peuvent souvent être conçues comme le simple effet naturel, iconique, de la répétition elle-même, sans qu'il soit nécessaire d'y voir un procédé particulièrement formalisé. Pourtant, certaines langues sont allées plus loin dans ce domaine, exploitant les propriétés de la réitération au point de leur donner un statut grammatical. On parle alors de redoublement ou réduplication, marque linguistique à part entière (voir par ex. Moravcsik 1978) : sur le plan morphologique, la réitération de segments est susceptible d'affecter la structure interne du mot lui-même, en donnant lieu à des formes partiellement imprévisibles que l'apprenant doit mémoriser telles quelles ; d'autre part, sur le plan fonctionnel, l'emploi de formes simples vs. rédupliquées sera régi par des principes sémantiques stricts, partiellement non-prédictibles là aussi, et différents d'une langue à l'autre. Il incombe alors au linguiste de décrire les propriétés morphologiques, syntaxiques et sémantiques de la réduplication, dans les langues qui exploitent ce procédé. Alors que les langues d'Europe ne connaissent guère que des procédés de répétition, l'usage de la réduplication proprement dite est largement attesté, entre autres, dans les langues d'Afrique (ex. Kabore 1998), d'Asie (ex. Haas 1946: 98), d'Amérique du Nord (Berlin 1963 ; Mithun 1996: 147) et du Sud (ex. Queixalós 1998: 193). Quant à la famille austronésienne, elle est aussi connue pour avoir considérablement développé cette technique : on la rencontre aussi bien dans les langues d'Indonésie (Gonda 1949, Nivens 1993) ou des Philippines (Blake 1917) que dans l'ensemble océanien, depuis la Mélanésie (ex. Ozanne-Rivierre 1986 pour les îles Loyauté) et la Micronésie (Bender 1971 ; Harrison 1973) jusqu'aux confins de la Polynésie (ex. Sperlich 2001 ; Lazard & Peltzer 2000). Nous voudrions ici présenter la diversité des fonctions que remplit la réduplication en * CNRS-LACITO, Langues et Civilisations à Tradition Orale – ¢[email protected]².

178

Alexandre François

La réduplication en mwotlap

179

mwotlap, une langue océanienne parlée au nord du Vanuatu par 1800 locuteurs (François 2001, 2003). Le choix de concentrer l'observation sur une langue unique permettra d'apprécier la manière dont un seul et même procédé morphologique est susceptible de s'infiltrer simultanément dans plusieurs aires du système : marquage du nombre, aspect verbal, valence et transitivité, dérivation et composition lexicales… Une étude comparative de la réduplication dans les langues austronésiennes, tout en révélant de réelles différences de détail entre les langues, présenterait à coup sûr, pour l'essentiel, un éventail de valeurs sémantiques très comparable à celui que nous allons voir pour le mwotlap.

rédupliquées, ont aujourd'hui perdu leur correspondant simple : en face de mulumlum ‘lent’, *mlum n'existe pas (ou plus) ; de même, l'analyse linguistique ne devra pas ranger yêyê ‘rire’ parmi les cas de réduplication, car la forme simple *yê n'est pas attestée. Ces exceptions sont particulièrement nombreuses du côté des adjectifs, lesquels ne présentent souvent qu'une forme à redoublement : ex. qagqag ‘blanc’, mêlêmlêg ‘noir’, bôybôy ‘gros’ ; ceci concerne également quelques noms : ex. ¼al¼al ‘fille’, na-bagbaglo ‘hirondelle’, nê-qêqêl ‘palétuvier’. Nous n'envisagerons donc ici que les lexèmes qui présentent en synchronie deux formes, une simple (X), une rédupliquée (X:DUP).

1. NOTES DE MORPHOLOGIE

2. LA REDUPLICATION SUR LES NOMS ET LES ADJECTIFS

Sans trop entrer dans le détail, nous présenterons d'abord un aperçu morphologique de la réduplication. Certaines langues présentent à ce titre un procédé très simple, consistant à redoubler la racine complète : ex. Indonésien standard anjing ‘chien’ o anjing-anjing ‘chiens’ (Dardjowidjojo 1978: 78). Mais dans le cas du mwotlap1, le processus de réduplication ne donne souvent lieu qu'à des redoublements partiels. Les seuls radicaux qui se retrouvent entièrement clonés sont les monosyllabes (V, CV, VC, CVC) : su ‘petit’ o susu ; in ‘boire’ o inin ; hag ‘assis’ o haghag ; alors que les radicaux plus longs ne répètent normalement que leur première syllabe : vaêh ‘sauver’ o vavaêh ; êglal ‘savoir’ o êgêglal ; ¼ôkheg ‘respirer’ o ¼ôk¼ôkheg – et parfois moins : vêhbeg ‘pendre’ o vêvêhbeg. Par ailleurs, des règles phonotactiques propres à cette langue (François 1999: 481), comme l'épenthèse d'une voyelle dans une séquence #CCV-, viennent compliquer l'observation : tôqô [< rad. TQO] ‘proscrire’ se réduplique en tôqôtqô [< TQOTQO], magaysên ‘triste’ en magamgaysên, sukul ‘école’ [SKUL < ang. school] en sukuskul. Combinées à des allophonismes consonantiques, ces règles rendent parfois le radical simple quasi méconnaissable : ainsi, vêgêl ‘ensorceler’ donne vêgêpgêl, et belekat ‘jouer aux cartes’ [BLEKAT < ang. play cards] donne belemlekat. Pour productives que soient les règles de réduplication, il n'en reste pas moins que ces séquences morphologiques sont généralement mémorisées telles quelles par l'apprenant. Ceci est prouvé par l'existence de formes exceptionnelles, non prédictibles (ex. liwo ‘grand’ o lililwo), et aussi, a contrario, par les hésitations que trahissent parfois les locuteurs lorsqu'il s'agit de forger une réduplication inédite (François 2001: 138). Par exemple, wulus ‘beau-frère’ se redouble tantôt en wuwulus, tantôt en wuluwlus ; et quant au verbe leveteg ‘poser’, il s'entend redoublé sous pas moins de six formes différentes, toutes parfaitement régulières (levetepteg, lepleveteg, leveveteg, levetveteg, leleveteg, levelveteg). Ceci étant dit, tous les radicaux ne présentent pas nécessairement une forme redoublée dans la langue : siseg ‘jouer’, momyiy ‘froid’, êtan ‘enceinte’ ne se rencontrent que sous cette forme. Et inversement, de nombreuses formes de la langue moderne, apparemment

La complexité morphologique de la réduplication n'est rien à côté des nuances de ses interprétations sémantiques. Nous commencerons par examiner le cas où le procédé porte sur des noms ou des adjectifs, avant d'observer le domaine plus foisonnant du verbe [§ 3].

1

Les conventions orthographiques du mwotlap incluent: ê [Ý]; ô [ý]; g [¥]; b [mb]; d [nd]; q [kpw]; ¼ [¹mw]; ¾ [¹]. Les abréviations utilisées dans les gloses sont : ACP ‘accompli’, AO ‘aoriste’, ART ‘article’, DEF ‘défini’, COLL ‘article collectif’, DU ‘duel’, DUP ‘forme rédupliquée’, NEG ‘négation’, PFT ‘parfait’, PROH ‘prohibitif’, PRSP ‘prospectif’, PRT ‘prétérit’, REL ‘relativiseur’, STA ‘Statif’, 1EX ‘nous exclusif’, 1IN ‘nous inclusif’.

2.1. Des référents multiples ? Dans certains cas, la réduplication reçoit la valeur iconique que l'on attend d'elle, à savoir la notion de pluralité. Ceci est vrai en particulier pour une poignée de noms, qui opposent un radical singulier à un radical pluriel : (1)

nêt¼ey tête-k (wô)lômgep na-hap

‘l'enfant’ ‘ma sœur’ ‘le garçon’ ‘la chose’

o o o o

ige nêtnêt¼ey ige ya-têtête-k ige lômlômgep na-haphap

‘les enfants’ ‘mes sœurs’ ‘les garçons’ ‘les choses’

Si aisé soit-il à concevoir, cet emploi strictement pluralisant de la réduplication est exceptionnel en mwotlap ; il ne concerne qu'une quinzaine de radicaux tout au plus. Normalement, les noms sémantiquement humains marquent leur nombre à l'aide d'un article collectif de forme ige, sans changement de radical : mayanag ‘le chef’ o ige mayanag ‘les chefs’. Quant aux noms non-humains, ils ignorent tout simplement le marquage du nombre (François 2001: 360-370) : n-ê¼ ‘maison(s)’ ; ne-men ‘oiseau(x)’ – la réduplication est inopérante ici. On retrouve cette valeur plurielle du redoublement avec d'autres parties du discours, mais toujours de façon exceptionnelle. D'une part, les morphèmes numéraux présentent, à leur manière, la notion de pluralité que nous venons de voir. La réduplication du numéral lui-même prend une valeur distributive : (2)

vitwag vôyô

‘un’ ‘deux’

o vivitwag o vôvôyô

‘un par un, un par personne’ ‘deux par deux, deux par personne’

– et à partir de l'adverbe vag-tiwag /multiplicateur-un/ ‘une fois’, on forme l'expression vagvag-tiwag ‘une fois de temps en temps, parfois’. Par ailleurs, des adjectifs comme su ‘petit’ et liwo ‘grand’ sont rédupliqués, entre autres, lorsqu'ils qualifient un référent sémantiquement pluriel :

180

Alexandre François (3)

ne-vet su n-et su n-et liwo

La réduplication en mwotlap

‘un petit caillou’ o ne-vet susu ‘des petits cailloux’ ‘un petit (un enfant)’ o ige susu ‘les petits (les enfants)’ ‘un grand (un adulte, un chef)’ o ige lililwo ‘les grands (les adultes, les chefs)’

Mais une fois de plus, il faut se garder ici des généralisations hâtives. D'abord, les adjectifs concernés se comptent sur les doigts d'une main (‘petit’, ‘grand’, ‘riche’, ‘pauvre’) ; et d'autre part, la pluralité du référent n'est qu'un sens possible pour ces adjectifs rédupliqués. Dans d'autres contextes, ne-vet susu n'aura pas une valeur plurielle ‘des petits cailloux’, mais une valeur intensive de l'adjectif : ‘un caillou minuscule’. De la même façon, lililwo est ambigu : (4)

n-ê¼ ART-maison

a. b.

LILILWO grand:DUP

‘de grandes maisons’ ‘une maison immense’

[lecture plurielle] [lecture intensive]

Le point commun entre les deux valeurs est abstrait. En un certain sens, elles impliquent toutes deux une lecture intensive de l'adjectif ‘grand’ ; dans un cas, il s'agit d'une intensité quantitative sur le mode du discret (de nombreux objets grands) – dans l'autre cas, d'une intensité qualitative, sur le mode du dense (un seul objet, très grand). 2.2. Augmenter, diminuer : le paradoxe de la fragmentation En somme, l'interprétation strictement pluralisante de la réduplication ne saurait rendre compte correctement des données. La notion de fragmentation semble plus prometteuse : c'est du moins ce qui apparaît lorsque l'on examine le domaine de la dérivation lexicale de nom à nom. Le mwotlap possède une série de couples nominaux (N vs. N:DUP), qui consistent à présenter une réalité similaire sous deux aspects distincts. D'un côté, la forme simple du radical désignera un référent unique – ou bien quelques référents, pourvu qu'ils soient perceptuellement isolables – et de taille moyenne : (5.a)

na-qya¾ ‘un trou, quelques trous’ (de taille moyenne, ex. 50 cm de diamètre)

À l'inverse, la forme rédupliquée aura tendance à désigner un grand nombre de référents de taille réduite, et spatialement contigus : (5.b)

na-qyaqya¾ ‘des dizaines de petits trous’ (de taille réduite, ex. 5 mm de diamètre)

Voici d'autres exemples, où la réduplication reçoit la même valeur, à la fois collective et – le plus souvent – diminutive : (6)

na-qlês na-qlêqlês

‘une flaque d'eau (de taille moyenne)’ ‘un grand nombre de petites flaques’

181

nô-gôyê-n nô-gôygôyê-n

‘une / quelques racine(s), individuée(s)’ ‘les (nombreuses) racines d'un arbre [ex. figuier]’

nê-wtê-n nê-wtêwtê-n

‘une branche (grosse, remarquable isolément)’ ‘le branchage’

ne-vet ne-vetvet

‘rocher(s), pierre(s), caillou(x)’ ‘la pierraille, la caillasse ; zone pierreuse’

na-mne-n na-mnemne-n

‘les deux mains ; ¢fleur² pétale(s) isolé(s)’ ‘¢fleur² ses pétales, sa corolle de pétales’

nê-qêtbuhu-k nê-qêtqêtbuhu-k

‘un de mes doigts (typiquement le pouce)’ ‘mes doigts’

La dérivation opère parfois sur une signification plus abstraite : (7)

ne-leg ne-legleg

‘le mariage, spéc. la cérémonie elle-même’ ‘l'ensemble des célébrations liées à un mariage’

Certes, dans tous ces exemples, on retrouve en partie la notion de multiplicité, que semble convoyer, iconiquement, le procédé de réduplication. Pourtant, il serait erroné d'y voir un simple procédé morphologique de pluriel – et ce, d'autant moins que ces formes à redoublement continuent d'impliquer un accord verbal au singulier, comme c'est la règle pour tous les non-humains. Il s'agit en fait ici d'une opération de dérivation lexicale, partant d'un lexème formellement singulier (X) pour produire un autre lexème singulier (X:DUP) ; la réduplication y joue un rôle fonction comparable à certains suffixes dérivationnels du français, comme on en trouve dans les couples feuille o feuillage, ou pierre o pierraille. Et de fait, ces derniers ne se réduisent pas non plus à de simples paires morphologiques singulier-pluriel. D'un côté, la forme simple représente la notion N comme un objet individué, dans sa compacité et sa singularité, quel qu'en soit d'ailleurs le nombre : ex. ne-vet ‘une pierre, des pierres’. De l'autre, la réduplication représentera la même notion sur le mode de la fragmentation. Souvent, ce processus prend une valeur de collectif, comme si la fragmentation notionnelle du référent impliquait également une accumulation quantitative (ex. ne-vetvet ‘la pierraille, zone où se trouvent des pierres en abondance’). Mais dans certains cas, l'éclatement de la notion de départ ne retient que le sème de petitesse, sans impliquer une collection d'objets contigus : (8)

n-êy n-êyêy

‘gros crustacé de mer : langouste, homard’ ‘petite crevette de rivière’

no-qol no-qolqol

‘poisson Chirurgien (Acanthurus sp.)’ ‘variété de Chirurgien, plus petite que no-qol’

On touche ici du doigt un paradoxe de la réduplication nominale. D'un côté, l'effet d'éclatement suggère une croissance en étendue, comme si fragmenter une entité revenait à la multiplier, à la distribuer sur un grand nombre d'occurrences – d'où les valeurs plurielles et collectives. Mais par ailleurs, ce même processus de fragmentation revient à

182

Alexandre François

représenter la notion N sous une forme réduite, comme s'il s'agissait, cette fois-ci, de la diviser – d'où les valeurs diminutives attestées en mwotlap, comme dans d'autres langues austronésiennes2. 3. LA REDUPLICATION SUR LES VERBES Excepté la vingtaine d'exemples que nous venons de citer, la grande majorité des noms ou des adjectifs est normalement inapte à la réduplication. S'il est une catégorie syntaxique par excellence sujette à ce procédé linguistique, c'est bien plutôt celle des verbes. Les occasions ne manquent pas, on va le voir, pour qu'un procès apparaisse sous sa forme rédupliquée : pluralité des arguments ou du procès lui-même, valeurs aspectuelles itératives (fréquentatif, habituel) ou progressives, détransitivation ou incorporation de l'objet… On ne s'étonnera donc pas de la grande affinité que les verbes3 présentent avec la réduplication. 3.1. Pluralité des actants ou du procès lui-même ? Comme nous l'avons vu pour les noms, un premier coup d'œil sur la réduplication verbale semble mettre en jeu la notion de pluralité. Ainsi, un énoncé comme le suivant présente un sujet pluriel, en même temps qu'un procès sémantiquement dispersé dans l'espace ; cette double pluralité, de l'actant et du procès, donne lieu à une forme rédupliquée :

La réduplication en mwotlap (10.b) Dôyô

so

1IN:DU

Ige

susu

kêy

COLL:PL

petit:DUP 3PL

GITGITYAK AO:courir:DUP

BIYIMYI¿ aider:DUP

PRSP

dôyô. 1IN:DU

‘Toi et moi, nous allons nous entraider.’ Néanmoins, on aurait tort de conclure à une simple équivalence verbe simple = sujet singulier / verbe rédupliqué = sujet pluriel. Car même s'il correspond à une réelle tendance, ce dernier principe souffre de nombreuses exceptions : on trouve très ordinairement des sujets pluriels avec des verbes simples, et inversement. Ainsi, si un sujet pluriel agit en groupe et en une seule fois, le verbe présente normalement sa forme simple (sauf si d'autres raisons l'en empêchent) : (11.a) Kêy

may

¼ôl.

3PL

ACP

rentrer

‘Ils sont déjà partis (en groupe).’ Inversement, la réduplication sera de rigueur si les sujets agissent séparément, soit individuellement soit par petits groupes : (11.b) Kêy

may

3PL

ACP

½OL½OL. rentrer:DUP

‘Ils sont déjà partis (séparément, les uns après les autres).’ Autre exemple : (12.a) Ige

(9)

183

SOLOSLOTEG. désordonné:DUP

COLL:PL

le-pnô

kêy

dans-pays 3PL

mat

qêt.

AO:mourir

tous

‘Tous les villageois moururent d'un coup.’

‘Les enfants courent dans tous les sens.’ (12.b) Ige De même, on ne s'étonnera pas qu'un procès réciproque – dont le sujet est nécessairement pluriel – implique la réduplication du verbe. Celle-ci correspond iconiquement à la notion de distributivité présente dans ces tournures : (10.a) Nok 1SG

so

BIYI¿

nêk.

PRSP

aider

2SG

‘Je vais t'aider.’

2

La même valeur diminutive est attestée en West Tarangan (Maluku, Est de l'Indonésie) : ex. s'ldi ‘crevette’ o s'ls'ldi ‘petite crevette’ (Nivens 1993: 384). De même en Manam (nord de la Papouasie) : moata ‘serpent’ o moata-moata ‘ver’ (Lichtenberk 1983: 611). Par ailleurs, on pourrait proposer d'expliquer de cette façon les effets hypocoristiques (surnoms, registre enfantin) assignés, dans de nombreuses langues du monde, à la réduplication : ex. français joujou, fifille, tonton. 3 En réalité, il arrive que les adjectifs, et parfois même les noms, se combinent aux mêmes marques aspecto-modales que les verbes, pour peu qu'ils soient lus comme des procès (François 2003). Par souci de simplicité, nous continuerons néanmoins à parler ici de "verbes", car ces derniers sont au centre des mécanismes qui nous intéressent.

COLL:PL

le-pnô

kêy

dans-pays 3PL

MATMAT AO:mourir:DUP

qêt. tous

‘Tous les villageois mouraient, les uns après les autres.’ En conséquence, le critère pertinent pour expliquer la réduplication sur le verbe n'est pas tant le nombre de son sujet, que de savoir si celui-ci agit de façon homogène, "comme un seul homme", ou bien de façon dispersée. Par exemple, dans l'énoncé (9), la réduplication ne s'explique pas tant par la pluralité du sujet, que par l'éclatement du procès dans l'espace. Une autre preuve qu'il faut découpler le nombre du sujet et celui du procès, est la possibilité d'attribuer une valeur plurielle au procès alors que le sujet est morphosyntaxiquement singulier. C'est le cas des noms à référents non-humains, qui en eux-mêmes ignorent l'opposition de nombre [§ 2.1], et impliquent un accord verbal au singulier. La réduplication sur le verbe, dans la mesure où elle indique un procès fragmenté, suggère – mais suggère simplement – que le sujet est en fait sémantiquement pluriel, comme en (13')-b : (13)

N-ê¼

ni-sisgoy.

ART-maison

AO:3SG-tomber

a. ‘La maison s'est écroulée.’ b. ‘Les maisons se sont écroulées (d'un coup).’

184

Alexandre François (13')

N-ê¼ ART-maison

ni-SISISGOY. AO:3SG-tomber:DUP

a. ‘La maison s'est écroulée par morceaux.’ b. ‘Les maisons se sont écroulées (çà et là, séparément).’ Ainsi, loin de résulter d'un accord purement mécanique entre le nombre des arguments et le verbe, la sélection de la bonne forme s'opère en fonction du sémantisme du procès luimême4 : – on a la forme simple si le procès P peut se réduire à une seule occurrence homogène ; –

on a la forme rédupliquée si ce procès P se trouve fragmenté d'une façon ou d'une autre, i.e. validé pour plusieurs sujets/objets séparément, ou distribué sur plusieurs occurrences hétérogènes.

La réduplication sur le verbe signale donc un éclatement du procès. Il peut s'agir d'une multiplicité de procès simultanés, comme les enfants de (9) qui se dispersent en courant, ou les (morceaux de) maison(s) qui s'écroulent çà et là (13). Il peut s'agir de procès distribués en plusieurs occurrences échelonnées dans le temps, comme les villageois de (12) qui trépassent les uns après les autres. Bien sûr, on peut avoir une combinaison des deux, comme dans le cas des fêtards qui rentrent chez eux en (11), successivement – dans le temps – et en ordre dispersé – dans l'espace. On retrouve là des valeurs typologiquement connues pour la réduplication, comme en témoigne l'étude de Kabore sur la réduplication dans les langues africaines (Kabore 1998: 367) :

La réduplication en mwotlap

lancé qu'une seule pierre (yim), et la mort qui s'en est ensuivie n'a eu lieu qu'une seule fois (mat) ; si ne-men réfère à plusieurs oiseaux, ils doivent être morts d'un seul coup – cf. ex.(12). Mais on peut également envisager le cas où le procès V1 (la lapidation) serait sémantiquement fragmenté, comme si plusieurs personnes lançaient des pierres contre un oiseau pour le tuer. Dans ce cas-là, la multiplicité des jets de pierres se traduirait par une réduplication de V1, sans affecter la forme V2 : (14.b) Kem

De façon remarquable, cette valeur de pluralité du procès lui-même fait l'objet d'un calcul distinct pour chacun des verbes dans une série verbale (François à paraître), en fonction des caractéristiques propres de chaque sous-procès. Ainsi, prenons l'exemple de la tournure causative [A ¢V1 V2² B]. Cette structure signifie qu'un premier procès biactanciel V1, reflétant l'action d'un agent A sur un patient B, provoque, pour cet élément B, un procès monoactanciel V2 : (14.a) No

mi-YIM

MAT

ne-men

en.

1SG PFT-lapider mourir ART-oiseau DEF [litt. J'ai LAPIDE MOURIR l(es) oiseau(x).]

‘J'ai tué l'oiseau (en lui jetant une pierre).’ Tel quel, l'énoncé (14.a) suggère une séquence de deux procès singulatifs : le sujet n'a 4

La question est notamment débattue à propos de certaines langues polynésiennes comme le niue. Alors que Sperlich (2001: 284) voit la réduplication du verbe comme le résultat d'un simple accord morphologique avec ses arguments ("grammatical agreement"), HajiAbdolhosseini & al. (2002) préfèrent l'interpréter en termes sémantiques, comme une caractéristique aspectuelle du procès ("pluractionality").

mi-YIMYIM

MAT

ne-men

en.

1EX:PL PFT-lapider:DUP mourir ART-oiseau DEF

‘Nous avons tué l'oiseau (en lui jetant des pierres).’ À l'inverse, on peut également imaginer un procès V1 unique, suivi d'un V2 multiple. Ce serait le cas, par exemple, si un seul jet de pierre (yim) pouvait tuer plusieurs fois (matmat) – en l'occurrence, tuer plusieurs oiseaux : (14.c) No 1SG

mi-YIM PFT-lapider

MATMAT mourir:DUP

ne-men

en.

ART-oiseau

DEF

‘J'ai tué les oiseaux (en leur jetant une seule pierre).’ Enfin, bien entendu, rien n'interdit de concevoir une situation où chacun des deux procès de la série verbale aurait une valeur distributive. Plusieurs lapidations, plusieurs trépas – c'est le cas, par exemple, si l'on envoie des pierres sur des oiseaux : (14.d) No 1SG

"La disjonction signifie qu'un procès ne s'applique pas de façon globale ou dense, mais avec discontinuité, soit sur le plan spatial ou temporel, soit sur le plan notionnel." 3.2. Un calcul recommencé pour chaque verbe

185

mi-YIMYIM PFT-lapider:DUP

MATMAT mourir:DUP

ne-men

en.

ART-oiseau

DEF

‘J'ai tué les oiseaux (avec des pierres, les uns après les autres).’ Une fois de plus, le nombre des actants sujets ou objets n'est pas directement marqué par la réduplication sur le verbe, il résulte simplement d'une inférence. En lui-même, ce procédé n'indique rien d'autre que le mode d'actualisation du procès (ou d'un sous-procès, dans une série verbale) : tantôt sur le mode du compact (X), tantôt sur le mode du disjoint (X:DUP). 3.3. L'habituel : construire une propriété La plupart des exemples cités jusqu'à présent illustraient des cas assez simples, dans lesquels ladite pluralité de l'action correspondait à une dispersion réelle des occurrences de procès, dans le temps et/ou dans l'espace, le plus souvent en rapport avec une multiplicité effective des actants. Mais lorsque tous les actants sont sémantiquement singuliers, la réduplication du verbe ne reçoit normalement qu'une interprétation temporelle. Ainsi, si l'on remplace ige susu ‘les enfants’ par n-et su ‘l'enfant’ en (9), la réduplication ne pourra pas être comprise comme un procès éclaté dans l'espace (*l'enfant court en ordre dispersé), mais exclusivement dans le temps : (9')

N-et

su

ART-personne

petit DEF

en,

kê

ni-GITGITYAK

SOLOSLOTEG.

3SG AO:3SG-courir:DUP désordonné:DUP

‘Ce gamin ne cesse de galoper dans tous les sens.’

186

Alexandre François

Et c'est ainsi que la réduplication du verbe est régulièrement exploitée en mwotlap pour coder la répétition d'un procès dans le temps, autrement dit, une valeur itérative. Nous entrons ici dans un domaine privilégié de la réduplication : l'aspect verbal. Ce procès itératif peut être conçu comme une qualité permanente, caractéristique inhérente du sujet. Il est alors combiné soit avec l'Aoriste (voir plus loin), soit avec le Statif, recevant une valeur d'habituel : (15.a) Kê 3SG

ne-mhay. STA-déchiré

‘C'est déchiré.’ (15.b) Kê 3SG

towoyig.

ne-MHAMHAY STA-déchiré:DUP

facile

‘Ça se déchire facilement.’ Fait notable, alors que les verbes aspectuellement dynamiques ne sont pas compatibles avec la marque du Statif, ils le deviennent sous leur forme redoublée : (16.a) *No

ne-gen

nê-mrêit.

1SG STA-manger ART-pain *[Je mangestatif un morceau de pain.]

(16.b) No 1SG

ne-GENGEN

nê-mrêit.

STA-manger:DUP

ART-pain

‘J'ai l'habitude de manger du pain, je suis amateur de pain.’

La réduplication en mwotlap

restreint à une situation particulière (un éblouissement momentané) – comme le prouve l'emploi du passé simple dans la traduction française. Mais tout en représentant chacune une "unique" occurrence de procès, les deux formes matbêy et matmatbêy s'opposent par leur aspect compact vs. fragmenté ; on retrouve les mêmes significations que dans les dérivés fréquentatifs du français, du type cligner o clignoter, taper o tapoter, tirer o tirailler. À chaque fois, un procès P (‘clignoter’) est conçu comme la multiplication d'un micro-procès ponctuel p (‘cligner’). Or, les propriétés sémantiques d'un procès fréquentatif P, même restreint à une situation, ne se confondent pas avec celles du procès ponctuel p dont il est dérivé. Par exemple, une caractéristique fondamentale est qu'il devient extensible dans le temps : alors que cligner se réduit à un instant, en revanche il est possible de prolonger indéfiniment l'acte de clignoter. Il ne s'agit pas seulement d'une question de durée, mais de toute une différence dans le comportement aspectuel du radical, son type-de-procès : d'un côté, on a un procès borné, voire ponctuel (p = ‘cligner’) ; de l'autre, un procès nonborné (P = ‘clignoter’), susceptible de se combiner avec des marques de durée. C'est grâce à ces propriétés sémantiques que le procédé de réduplication entre dans la formation du progressif mwotlap, de forme { Aoriste + réduplication }. Point remarquable, cette dernière combinaison est ambiguë, puisqu'elle code : a. l'habituel : un procès se réitère indéfiniment, de façon discontinue, tout au long d'une situation temporellement étendue (ex. plusieurs années) ; b. le progressif : un procès dynamique est en cours d'actualisation à l'instant de référence. (18)

ART-yeux-3SG

ni-matbêy. AO:3SG-cligner

‘Il cligna des yeux.’ (17.b) Na-mta-n ART-yeux-3SG

[un seul clignement]

ni-MATMATBEY. AO:3SG-cligner:DUP

‘Il clignota des yeux.’

Nok 1SG

Mais la valeur itérative de la réduplication ne se réduit pas à cette interprétation habituelle, à portée générique. On peut la retrouver à l'œuvre y compris dans le contexte d'une situation unique, aspectuellement dynamique. Un premier cas de figure, à savoir la valeur fréquentative, reste proche de la notion de pluralité du procès, que nous avons vue aux § 3.1 et 3.2 :

[plusieurs clignements]

Ici, il ne s'agit pas de prédiquer une propriété permanente, essentielle, du sujet na-mta-n ‘ses yeux’, comme s'ils avaient pour habitude de cligner ; il s'agit d'un procès unique,

ni-ETET AO:3SG-voir:DUP

nêk. 2SG

a. ‘Papa a l'habitude de te voir / te regarder (chaque matin…).’ b. ‘Papa est en train de te regarder.’ (19)

(17.a) Na-mta-n

Imam père

C'est la preuve que la réduplication, à travers sa valeur d'habituel, a le pouvoir de recatégoriser un verbe dynamique en une propriété stative, aspectuellement homogène (François 2003: 81; 358). 3.4. Du fréquentatif au progressif

187

WOSWOS AO:clouer:DUP

n-ê¼

mino.

ART-maison

ma

a. ‘Je fais du bricolage (tous les dimanches…).’ b. ‘Je suis en train de faire du bricolage.’ Ainsi, malgré des différences sémantiques réelles entre les aspects habituel et progressif, le mwotlap privilégie leur similarité. Dans les deux cas, une situation de référence se trouve caractérisée par un procès P, extensible dans le temps ; ce procès P est conçu, au moyen de la réduplication, comme la réitération indéfinie d'un micro-procès p, lui-même ponctuel. Du point de vue typologique, cette stratégie aspectuelle ne manque pas d'intérêt. Le progressif, qui est généralement conçu, dans certaines langues, comme le déroulement d'une seule occurrence de procès (ex. he is looking at you), est codé en mwotlap – et dans bien d'autres langues à réduplication – comme s'il s'agissait de se plonger au cœur d'une série d'événements successifs : le duratif woswos ‘être en train de bricoler’ n'est autre que la multiplication de plusieurs micro-procès wos ‘enfoncer un clou’. C'est ainsi que la réduplication permet de constituer des formes non-bornées (woswos) à partir de radicaux intrinsèquement bornés (wos) – cf. François (2003: 168-178; 360).

188

Alexandre François

Et de fait, le verbe doit être redoublé chaque fois qu'un procès télique n'atteint pas son terme. Considérons le verbe mtiy ‘s'endormir’. Telle quelle, la forme simple implique que la borne finale de ce procès télique a été franchie : ART-bière

ni-wuh

no,

tô

nok

AO-frapper

1SG

alors 1SG

mitiy. AO:s'endormir

‘La bière m'a assommé, et je me suis endormi.’ Mais si ladite borne finale n'est pas atteinte, alors la réduplication devient nécessaire, car elle seule a le pouvoir de "détéliciser" un radical télique. C'est le cas, typiquement, avec l'adverbe lêlêge ‘(faire P) en vain, sans succès’ : (20.b) Nok 1SG

so

mitiy :

nok

PRSP

s'endormir

1SG

189

syntagme objet serait obligatoirement interprétée comme une anaphore zéro (comme c'est usuel avec les patients inanimés définis) vers un objet référentiel présent dans le contexte :

3.5. Le conatif : un nouveau paradoxe

(20.a) Ni-bia

La réduplication en mwotlap

MITIMTIY AO:s'endormir:DUP

lêlêge. sans.succès

[litt. ‘Je voulais m'endormir (mais) je m'endormais sans succès.’] ‘Je n'ai pas réussi à m'endormir.’ Plus encore que la lecture progressive observée en (18), cette valeur conative constitue un nouveau paradoxe. Jusqu'à présent, nous avions vu que la réduplication d'un verbe référait normalement à un procès réitéré, démultiplié, sur le mode de l'accumulation. Pourtant, en (20.b), la signification observée est inverse : au lieu de signifier "faire P plusieurs fois", la forme verbale doit se gloser ici "faire P moins d'une fois, même pas une fois". De façon frappante, on retrouve dans le domaine verbal la même dualité que nous avions vue pour la dérivation nominale [§ 2.2] : à travers le fractionnement de la notion X, la réduplication avait le pouvoir tantôt d'en accroître l'étendue (collectif, type feuille o feuillage), tantôt, au contraire, de la diminuer (diminutif, type langouste o crevette). Cette ambivalence prévaut également dans la sémantique de l'aspect verbal. Telle quelle, la forme simple réfère typiquement à une occurrence de procès unique, aux contours externes nettement délimités – ex. mitiy = ‘s'endormir une fois, tomber dans le sommeil’. Le redoublement du verbe, à travers la fragmentation du procès P, évoque sa réitération indéfinie ; mais ce faisant, il estompe les contours sémantiques nets que pouvait avoir l'occurrence simple, au point de pouvoir convertir un événement borné dans l'activité non-bornée correspondante. Cette dernière est alors foncièrement ambiguë, évoquant tantôt l'accumulation de procès P achevés (d'où les effets itératifs mitimtiy = ‘s'endormir plusieurs fois, s'endormir souvent…’), tantôt l'atomisation de P sous la forme de tentatives lacunaires (valeur conative/imperfective mitimtiy = ‘tenter de s'endormir, recommencer indéfiniment l'endormissement sans jamais y arriver vraiment’).

(21.a) Nok 1SG

so

gen.

PRSP

manger

La forme rédupliquée gengen présente un tout autre comportement. Du fait de sa pluralité interne, gengen suggère un procès réitéré, par exemple habituel ; dans ce dernier cas, son objet ne peut plus être référentiel, et devient sémantiquement générique : c'est ce que nous avons vu dans l'exemple (16.b). Par ailleurs, en concevant une série indéfinie de microprocès bornés gen ‘manger qqch’, on peut construire le procès non-borné et intransitif gengen ‘manger, se nourrir’ : (21.b) Nok 1SG

so PRSP

Ce processus de détélicisation présente des conséquences remarquables sur la transitivité. En défaisant les bornes du procès, la réduplication a le pouvoir soit d'affranchir certains verbes de leur objet (détransitivation), soit, tout du moins, d'en modifier les propriétés sémantiques (passage du référentiel au générique). Par exemple, sous sa forme simple, le verbe gen ‘manger’ est obligatoirement pourvu d'un objet référentiel : ex. gen n-apol gôh ‘manger cette pomme’). L'absence d'un

GENGEN. manger:DUP

(*Je veux le manger.)

‘Je veux manger.’

Ces effets intransitifs sont une conséquence directe de la détélicisation opérée par la réduplication. Ceci dit, le phénomène ne concerne pas seulement les compléments d'objet. Il caractérise en fait tous les arguments susceptibles de constituer un bornage aspectuel externe au verbe : par exemple, les compléments locatifs des verbes de direction. Tel quel, le verbe van ‘aller (qq part)’ est télique, et implique obligatoirement la référence à une cible spatiale spécifique. (22.a) Inti-k fils-1SG

mal

van

Numea.

ACP

aller

N.

‘Mon fils est parti à Nouméa.’ (22.b) Inti-k fils-1SG

mal

van.

ACP

aller

‘Mon fils est parti (là-bas).’ Là aussi, l'absence de locatif serait interprétée comme une allusion à un voyage déjà préconstruit dans le contexte (‘Ça y est, il est parti [là où il était prévu qu'il parte]’). En revanche, la forme redoublée vanvan ne comporte pas obligatoirement la référence à une destination précise, et peut recevoir un locatif générique : (22.c) Inti-k

mal

fils-1SG ACP

3.6. Détéliciser, c'est détransitiver

(*Je veux manger.)

‘Je veux [le] manger.’

VANVAN aller:DUP

le-pnô

tegtegha.

dans-pays différent:DUP

‘Mon fils s'est déjà rendu dans de nombreux pays.’ Enfin, cette même forme vanvan peut également se dépouiller de toute orientation vers un but, et désigner alors l'action même de marcher :

190

Alexandre François (22.d) Inti-k

mal

fils-1SG ACP

VANVAN. aller:DUP

5

‘Ça y est, mon fils marche .’ (ex. bébé qui fait ses premiers pas) 3.7. L'incorporation de l'objet On ne s'étonnera pas du lien qui existe entre ce type de réduplication, à effet détransitivant, et l'incorporation de l'objet. En règle générale, le complément d'objet, qu'il soit référentiel ou non, apparaît à l'extérieur du syntagme verbal (indiqué ici par des crochets pointus, et par le prétérit mE-… tô), et précédé de l'article nA- – cf. ex. (14), (16), (19) et (23.a) : (23.a) No 1SG

¢mê-têq

PRT1-chasser

tô²

no-qon

vôyô.

PRT2

ART-pigeon

deux

‘J'ai chassé deux pigeons.’ Formellement parlant, la structure à objet incorporé consiste à démouvoir le patient de la position d'actant objet, pour le faire entrer à l'intérieur même du syntagme verbal, en position de modifieur interne du verbe : (23.b) No 1SG

¢mê-TEQTEQ

PRT1-chasser:DUP

QON

tô²

lê-¼êt.

pigeon

PRT2

dans-forêt

‘Je suis allé chasser le pigeon en forêt.’ La tournure présente trois propriétés morphosyntaxiques importantes : – réduplication du verbe ; – absence de l'article nA- à fonction "substantivante" (Lemaréchal 1989) sur l'objet incorporé : le nom se retrouve alors en fonction de simple qualifiant ; – absence de tout autre objet externe. La différence sémantique entre ces deux énoncés est claire. En (23.a), un procès biactanciel est associé à un patient, référentiel et dénombrable : on fait allusion à deux volatiles qui existent bel et bien. En (23.b), le patient a perdu toute référentialité (cf. Givón 1984: 416). Le nom qon ne désigne plus un ou plusieurs pigeons réels, mais prend une valeur purement intensionnelle : il sert simplement à définir un sous-type de chasse (la ‘chasse au pigeon’). Parallèlement à cette "dé-référentialisation" du patient, le verbe lui-même ne désigne plus une action sémelfactive et télique (têq ‘atteindre [qqch] au lance-pierres’), mais une activité atélique, aspectuellement non-bornée (têqtêq ‘se livrer à la chasse au lance-pierres’). Tout se passe comme si, en mwotlap, cette activité P était représentée comme la réitération indéfinie du micro-événement p. Voilà donc pourquoi, en mwotlap comme dans d'autres langues de la même famille6, l'incorporation 5

En perdant ses compléments référentiels, la forme rédupliquée perd une fois de plus sa télicité ; il en résulte des effets d'ordre aspecto-temporel – comme l'Accompli traduit par un présent en (22.d) – que nous ne détaillerons pas ici (cf. François 2003: 358). 6 Dans d'autres langues, cette règle ne s'observe plus que de façon indirecte. Ainsi, en iaai (Ouvéa, îles Loyauté), l'incorporation d'un nom objet implique toujours la forme "indéterminée" du verbe : ex. oc ‘arracher’ o uuk k‹Õi0 ‘faire la récolte des taros’ ; kot ‘taper’

La réduplication en mwotlap

191

de l'objet met en jeu la réduplication du radical verbal. Au bout du compte, l'ensemble têqtêq-qon peut être considéré comme un composé lexical, verbe uniactanciel, désignant un certain type d'activité. Le phénomène de l'incorporation est d'ailleurs assez limité, puisqu'il ne concerne que certaines pratiques coutumières (chasser-le-N…, pêcher-le-N…, planter-le-N…), susceptibles de colexicalisation. 4. DU VERBE AU NOM : DERIVATION ET COMPOSITION 4.1. L'infinitif : le procès virtuel À travers ces emplois imperfectivants, la réduplication du radical verbal permet donc de désigner, en quelque sorte, le "procès lui-même", indépendamment de tout objet spécifique, indépendamment aussi de tout ancrage dans une occurrence particulière d'action. Rien de surprenant, dès lors, que cette même réduplication serve à désigner la valeur abstraite et générique d'une action P, impliquant les propriétés qualitatives de P plutôt que son actualisation. C'est sans doute de cette façon que l'on peut expliquer la règle de réduplication quand le verbe s'associe à certains auxiliaires ou opérateurs aspecto-modaux, du type qtêg (‘commencer’), myôs (‘vouloir’), êglal (‘savoir’), nitog (Prohibitif) : (24)

Kê

mal

qêtêg

TOYTOY.

3SG

ACP

commencer

discourir:DUP

‘Il a déjà commencé à discourir.’ (25)

Nok

et-buste

1SG

NEG1-(vouloir:NEG2)

GENGEN manger:DUP

n-age

anen.

ART-chose

là

‘Je ne veux pas manger ce truc-là.’ (26)

Nêk

n-êglal

VETVET

na-tamge ?

2SG

STA-savoir

tresser:DUP

ART-natte

‘Sais-tu tresser les nattes ?’ (27)

Nitog PROH

HAGHAG assis:DUP

hôw

anen !

(bas)

là

‘Ne va pas t'asseoir là.’ Ce genre d'énoncés ne réfère pas à une occurrence spécifique du procès P, dont on pourrait déterminer les bornes dans le temps. Chaque fois, P est plutôt mentionné pour son contenu notionnel, hors actualisation ; et s'il y a bien actualisation dans une situation, celle-ci s'opère non pas à travers P, mais à travers l'opérateur dont P est le complément (qtêg, êglal, nitog…). La forme rédupliquée du verbe, dans ce type de structures, rappelle la valeur intensionnelle que peut recevoir, en français, un mode comme l'infinitif. o xuc bü ‘chasser la roussette’ (Ozanne-Rivierre 1976: 123; 213). Or, cette forme indéterminée, qui se caractérise aujourd'hui par des altérations consonantiques et/ou vocaliques du radical (ex. oc ~ uuk, kot ~ xuc), est issue historiquement d'une ancienne réduplication (Ozanne-Rivierre 1986, 1992; Ozanne-Rivierre & Rivierre, ce volume).

192

Alexandre François

La réduplication en mwotlap

193

4.2. Les noms déverbaux

son opacité en synchronie a rendue désuète.

Et précisément, ce n'est sans doute pas un hasard si l'équivalent de l'infinitif dans beaucoup de langues, à savoir le nom abstrait d'action (Lemaréchal 1989: 153), s'obtient également par la réduplication du verbe7. Dans la mesure où le résultat de la dérivation est un nom, il est compatible avec l'article nA- :

4.3. Dérivation affixale et composition

(28)

te¾ et dêm hole haytêyêh

‘pleurer’ ‘voir’ ‘penser’ ‘parler’ ‘égal, adéquat’

o o o o o

ne-te¾te¾ n-etet nê-dêmdêm no-hohole na-hayhaytêyêh

‘les sanglots’ ‘la vision, l'opinion’ ‘la pensée, l'idée’ ‘la parole, la langue’ ‘l'égalité, l'analogie’

Si le verbe est transitif, le nom d'action s'obtiendra en combinant le radical verbal rédupliqué (o nom N1) à un nom N2 sans article, représentant le patient. On retrouve exactement la structure à objet incorporé ¢VDUP N², étudiée au § 3.7 : (29)

têq no-qon dow nê-tqê

‘chasser le(s) pigeon(s)’ o nê-têqtêq qon ‘la chasse aux pigeons’ [cf. (23.b)] ‘désherber le jardin’ o no-dowdow têqê ‘le désherbage, l'entretien du jardin’

Pour finir, la réduplication du radical verbal est également requise dans certains processus productifs de dérivation par préfixation, comme pour former certains noms d'instruments en qêt- (étym. ‘bâton pour…’) ou en wô- (étym. ‘fruit’ > ‘objet pour…’) : (31)

‘mourir’ o na-matmat ‘la mort ; le mort’ ‘manger’ o ne-gengen ‘le repas ; la nourriture’ ‘tenir’ o nê-têtêy ‘la charge, le fardeau’ ‘composer’ o no-towtow ‘la composition ; l'équerre’ ‘composer un chant’ o no-towtow eh ‘la poésie ; le poète’ san ni-sis ‘ceindre la poitrine’ o na-sansan sis ‘le soutien-gorge’

mat gen têy tow tow n-eh

Ce processus donne la clef des liens étymologiques que l'on perçoit parfois entre tel nom et tel verbe : ainsi, nu-wutwut ‘colline, montagne’ est en fait dérivé du verbe wut ‘faire saillie, être protubérant’ ; et le nom poétique du soleil ne-heyhey n'est autre que le nom déverbal de hey ‘briller’. Du fait de sa haute motivation en synchronie, la dérivation par réduplication favorise, historiquement, les renouvellements lexicaux : nu-wutwut concurrence aujourd'hui le nom hérité na-tô (‘montagne’), et le nom transparent na-matmat a d'ores et déjà détrôné la forme plus ancienne na-mte (‘la mort, le mort’), que

(32)

o nê-qêt-balbal o nê-qêt-geyegyeh o nô-wô-têqtêq o nô-wô-ipip o nô-wô-dimdim

‘pince’ ‘râpe’ ‘projectile, munition’ ‘sifflet, appeau’ ‘bonbon’

‘cuire, cuisiner’ o n-ê¼ qa¾qa¾yis [maison (pour) cuire] ‘mordre’ o na-tno ¾it¾it [endroit mordre] ‘taper du pied, marcher bruyamment’ o ne-le¾ vayvay [vent taper-du-pied] ‘ensorceler, jeter un sortilège’ o n-et vêgêpgêl [homme ensorceler]

qa¾yis ¾it vay vêgêl

‘la cuisine’ ‘la morsure’ ‘le tonnerre’ ‘le sorcier’

En d'autres termes, un verbe ne peut venir modifier un nom N1 qu'après avoir subi luimême un processus de dérivation en nom, à l'aide de la réduplication8. Par exemple, le verbe qa¾yis ‘cuisiner’ est d'abord nominalisé sous la forme (na-) qa¾qa¾yis ‘la cuisson, l'art de cuisiner [nom d'action] ; les aliments cuits [nom de patient]’. Dans un second temps, ce nom abstrait d'action est employé (sans article) comme modifieur d'un autre nom, dans une structure ¢N1 N2² très courante en mwotlap : ainsi, le syntagme n-ê¼ QA¿QA¿YIS ‘maison de cuisson = cuisine’ est strictement parallèle à n-ê¼ GOM ‘maison de maladie = hôpital’. Enfin, si le verbe est transitif, on obtient des structures de composition à emboîtements, comme ¢ N1 (VDUP N2) ² ou ¢ N1 (prépo-VDUP N2) ² : (33)

ne-men

ININ

ART-oiseau

boire:DUP

‘une libellule’ (34)

na-tle ART-fer

‘un rabot’

7

Sauf exception (ex. haytêyêh cité ici), les adjectifs se comportent ici différemment des verbes, dans la mesure où leur nom dérivé (nom de qualité) ne requiert pas la réduplication ; la dérivation est alors une simple conversion sew ‘chaud’ o ne-sew ‘la chaleur’ ; ¼ya ‘drôle’ o na-¼ya ‘la drôlerie, le rire’. Il en va de même pour quelques verbes sémantiquement statiques : dêmap ‘respecter’ o nê-dêmap ‘le respect’ ; myôs ‘aimer, vouloir’ o na-myôs ‘le désir’ [+statique] – mais na-myômyôs ‘l'idylle’ [+dynamique].

‘enserrer’ ‘râper’ ‘lapider’ ‘souffler dans’ ‘sucer’

C'est toujours sous sa forme rédupliquée qu'un verbe viendra qualifier un nom N1, pour former un composé nominal ¢N1 VDUP². Ce dernier permet de désigner un instrument, un lieu, un agent… associés à telle ou telle activité :

S'il est vrai que ces noms d'action, formés par réduplication du verbe, servent normalement à désigner le procès lui-même, la même stratégie est parfois employée pour dériver des noms d'agents, de patients ou d'instruments : (30)

bal gyeh têq ip dim

SIYSIYVEG raboter:DUP

bê eau

[volatile à boire l'eau] qêtênge bois

[fer à raboter le bois]

Le même processus s'observe, par exemple, en West Tarangan [ici n.2 p.182] : ex. npa ‘envelopper’ o rataún np-npa ‘sagou enveloppé dans des feuilles’ (Nivens 1993: 377).

8

194

Alexandre François (35)

n-et

ba-LA½LA½

vêtôy

ART-personne

pour-battre:DUP

tambour

‘le percussioniste’

[personne pour battre tambour]

Tous ces exemples de dérivation ou de composition ont un point commun : le radical verbal en jeu ne réfère jamais à une occurrence spécifique de procès, laquelle se réduirait à une situation particulière ; à chaque fois, il s'agit plutôt de référer à un procès P dans sa dimension générique, qualitative, virtuelle. CONCLUSION Le cheminement sémantique est long et sinueux, qui mène d'une valeur plurielle ou distributive, jusqu'à la constitution d'infinitifs ou de noms d'agent. Pourtant, notre analyse a montré combien la sémantique de la réduplication en mwotlap, à travers ses multiples configurations syntaxiques ou lexicales, était en fait régie par une puissante cohérence interne, abstraite et transcatégorielle. Tel quel, un radical simple (nom, verbe, etc.) aura tendance à représenter son référent comme une entité discrète et autonome, pleine, pourvue d'une extension finie dans l'espace ou le temps. L'opération de réduplication, à l'inverse, présente la même notion sur le mode de la fragmentation : l'unité close de départ se disperse en une multiplicité d'occurrences, et perd du même coup la précision de ses limites externes. C'est ainsi qu'un seul et même procédé morphologique – non seulement en mwotlap, mais dans les nombreuses langues, austronésiennes ou non, qui connaissent ce phénomène – peut endosser des fonctions de pluriel, d'intensif, de collectif, de diminutif, de distributif, de réciproque, d'habituel, de fréquentatif, de progressif, de conatif, d'atélique, d'intransitif, d'infinitif… Au bout du compte, tout se passe comme si la réduplication, en fractionnant indéfiniment la notion, permettait d'atteindre à sa pureté même, alliage de virtualité et de renouvellement perpétuel.

REFERENCES Bender, Byron. 1971. Micronesian languages. In T. Sebeok (ed.) Linguistics in Oceania. Current Trends in Linguistics, vol.8. The Hague: Mouton & Co. Pp. 426-465. Berlin, Brent. 1963. Some semantic features of reduplication in Tzeltal. International Journal of American Linguistics, 29: 211-218. Blake, Frank R. 1917. Reduplication in Tagalog. American Journal of Philology, 38.4: 425-431. Dardjowidjojo, Soenjono. 1978. Sentence patterns of Indonesian. PALI language texts: Southeast Asia. Honolulu: University of Hawai'i Press. François, Alexandre. 1999. Mouvements et clonages de voyelles en motlav: Entre phonologie et morphologie. Bulletin de la Société de Linguistique XCIV-1, 437-486. François, Alexandre. 2001. Contraintes de structures et liberté dans l'organisation du discours. Une description du mwotlap, langue océanienne du Vanuatu. Thèse de Doctorat, Université Paris-IV Sorbonne. 3 vol., 1078 pp. François, Alexandre. 2003. La sémantique du prédicat en mwotlap (Vanuatu). Collection Linguistique de la Société de Linguistique de Paris, LXXXIV. Paris, Louvain: Peeters. François, Alexandre. 2004. Chains of freedom: Constraints and creativity in the macro-

La réduplication en mwotlap

195

verb strategies of Mwotlap. In I. Bril & F. Ozanne-Rivierre (eds), Complex predicates in Oceanic languages: Studies in the dynamics of binding and boundness. Empirical Approaches to Language Typology. Berlin: Mouton de Gruyter. Pp. 107-143. Givón, Talmy. 1984. Syntax. A functional-typological introduction, vol.1. AmsterdamPhiladelphia: Benjamins. Gonda, J. 1949. The functions of word duplication in Indonesian languages. Lingua, 2: 170-197. Haas, Mary. 1946. Techniques of intensifying in Thai. Word, 2: 127-130. Haji-Abdolhosseini, Mohammad; Massam, Diane & Oda, Kenji. 2002. Number and Events: Verbal Reduplication in Niuean. Oceanic Linguistics 41 (2): 475-492. Harrison, Sheldon. 1973. Reduplication in Micronesian. Oceanic Linguistics 12: 407-454. Kabore, Raphaël. 1998. La réduplication. In S. Platiel & R. Kabore (eds), Les langues d'Afrique subsaharienne. Faits de langues 11-12. Gap/Paris: Ophrys. Pp. 359-376. Lazard, Gilbert & Peltzer, Louise. 2000. Structure de la langue tahitienne. Langues et Cultures du Pacifique. SELAF n°391. Paris, Louvain: Peeters. Lemaréchal, Alain. 1989. Les parties du discours, Syntaxe et sémantique. Linguistique Nouvelle. Paris: PUF. Lichtenberk, Frantisek. 1983. A grammar of Manam. Oceanic Linguistics Special Publications, 18. Honolulu: University of Hawaii Press. Michailovsky, Boyd. 1988. La langue hayu. Sciences du Langage. Paris: Éditions du CNRS. Mithun, Marianne. 1996. Overview of General Characteristics. In I. Goddard (ed.) Handbook of North American Indians, Vol.17: Languages. Washington: Smithsonian Institution. Pp. 137-157. Moravcsik, Edith. 1978. Reduplicative constructions. In J. Greenberg (ed.) Universals of Language, vol.3. Stanford University Press. Pp. 312-334. Nivens, Richard. 1993. Reduplication in four dialects of West Tarangan. Oceanic Linguistics 32, 353-388. Ozanne-Rivierre, Françoise. 1976. Le iaai, Langue mélanésienne d'Ouvéa (NelleCalédonie). Phonologie, morphologie, esquisse syntaxique. Langues et cultures du Pacifique. Paris: Société d'Etudes Linguistiques et Anthropologiques de France. Ozanne-Rivierre, Françoise. 1986. Redoublement expressif et dédoublement des séries consonantiques dans les langues des îles Loyauté (Nelle-Calédonie). In C. Corne & A. Pawley (eds), Le coq et le cagou: Essays on French & Pacific languages in honour of Jim Hollyman [Te Reo 29]. Pp. 25-53. Ozanne-Rivierre, Françoise. 1992. The Proto-Oceanic consonantal system and the languages of New Caledonia. Oceanic linguistics 31, 191-207. Queixalós, Francisco. 1998. Nom, verbe et prédicat en sikuani (Colombie). Langues et sociétés d'Amérique traditionnelle, 6. Louvain, Paris: Peeters, SELAF. Sperlich, Wolfgang. 2001. Semantic and syntactic functions of reduplication in Niuean. In J. Bradshaw & K. Rehg (eds), Issues in Austronesian morphology: A focusschrift for Byron W. Bender. Pacific Linguistics, 519. Canberra: Australian National University. Pp. 279-287.

Reconstructing the Geocentric System of Proto-Oceanic Alexandre François lacito-cnrs, paris A comparison of the absolute coordinates used in space reference by sixteen Austronesian languages makes it possible to propose a hypothesis regarding the geocentric system of Proto-Oceanic: on land, one up–down axis de²ned by the declivity of the ground; at sea, a second up–down axis motivated by the prevailing trade winds. After reconstructing the system of Proto-Oceanic, we model the principal paths of evolution that derived from it historically and led to the diverse systems attested in modern Oceanic languages.

1. INTRODUCTION. In the last decade, several theoretical and typological studies have improved our understanding of how languages encode space reference. In particular, the research conducted by the Cognitive Anthropology Research Group at Nijmegen’s Max Planck Institute of Psycholinguistics (Brown and Levinson 1992, 1993; Levinson 1992, 1996a,b,c; Haviland 1993) has attracted the attention of linguists to the diversity of space-encoding strategies attested among the languages of the world, speci²cally in language families that until then had been hardly explored—for example, in Mayan and Australian Aboriginal languages. In parallel with these typological studies, an increasing number of Oceanic and Austronesian languages have been investigated with regard to these space issues (see Bowden 1992; Senft ed. 1997, forthcoming; Bennardo 2002). These explorations of Oceanic space systems have essentially been conducted in a synchronic perspective, often with the aim to describe the internal consistency of one particular language at a time; incidentally, this was precisely our own motivation when we ²rst undertook the description of space directionals in Mwotlap, a language of northern Vanuatu (François 2003). Today, even if the majority of Oceanic languages remain unexplored on these matters, the quantity and quality of existing information already seem suf²cient for us to formulate synchronic generalizations across Oceanic languages—as a follow-up to Senft (1997) or Palmer (2002a)—and to suggest historical hypotheses about the space reference system of their common ancestor. It is therefore the aim of this paper to reconstruct the geocentric system of Proto-Oceanic (POc).1 1. As we were writing a case study of space directionals in Mwotlap (François 2003), the attempt to compare Mwotlap with other Oceanic languages eventually led us to devote a full article to this matter. We are grateful to Françoise Ozanne-Rivierre, Malcolm Ross, Byron Bender, and two anonymous readers for commenting on earlier drafts of this paper. Oceanic Linguistics, Volume 43, no. 1 (June 2004) © by University of Hawai‘i Press. All rights reserved.

2

oceanic linguistics, vol. 43, no. 1

the geocentric system of proto-oceanic

3

After outlining brie³y the general properties of a geocentric system (section 2), we begin our investigation with a synchronic comparison of geocentric systems in a sample of sixteen modern Austronesian—mainly Oceanic—languages (section 3). Later sections are dedicated to a tentative reconstruction of the system at POc-level (section 4) and the historical scenarios that most probably led from POc to the present (section 5).

THE LEFT of the post, where the post is only oriented relatively to a facing observer. But however widespread they are, these two encoding strategies—named respectively “intrinsic” and “relative” frames of reference by Levinson (1996a)—appear to be hardly used in several language families, including the major part of Oceania (Senft 1997, Palmer 2002a). Instead, these languages make systematic use of a different linguistic device: an “absolute” frame of reference, based on geocentric coordinates.

2. GENERAL PROPERTIES OF OCEANIC GEOCENTRIC SYSTEMS

2.2 OCEANIC GEOCENTRIC SYSTEMS. Indeed, among the diverse types of landmarks that are known to grammaticalize across languages, one deserves special attention in the framework of this paper. Many space-referring systems are built upon certain outstanding natural and geographical spots, like the sea, a mountain, a river, the sun, the wind, and so on. In some cases, the relationship to a speci²c landscape’s topography is still precise and obvious, as in contrasts such as upriver–downriver; but many languages have also developed more abstract systems of reference, whose physical motivation has been blurred through time—as is the case with our cardinal points north-east-south-west, which were historically based on the rising and setting of the sun (Palmer 2002a:116, after Buck 1949). Whatever the case, these geographically based strategies will be here designated by the technical term “geocentric.” Such a system can be found in Guugu Yimidhirr (Haviland 1993), in Tzeltal (Levinson and Brown 1993), and Tzotzil (de León 1994). As far as modern Oceanic languages are concerned, the most common situation is a morphological set of verbs or directional particles that de²ne four orthogonal directions, hence dividing the horizontal plane into four quadrants. In a way, these four-term sets are similar to the four cardinal points we know in Europe and elsewhere, yet two important differences must be underlined. First, in European languages, the geocentric system is mainly restricted to long-distance vectors (e.g., the southern sea, but ?the southern chair), whereas Oceanic languages commonly resort to geocentric reference for all degrees of distance, from the largest to the smallest: virtually, this is how they encode any horizontal vector. Second, the four-term systems used in Oceania seldom match exactly the four cardinal directions of our European compass north-east-southwest (Codrington 1885:165), and sometimes appear to be drastically pivoted from these. In the latter case, it is a matter of debate whether their historical motivation is also the path of the sun, or another parameter (see 3.3.3). Other differences will appear soon, but these two already suf²ce to give a ²rst approximation of how Oceanic geocentric systems work. A typical example of such a system is provided in ²gure 1. It represents the four directions used for spatial reference in Kokota, a language spoken on Santa Isabel in the Solomons; more precisely, it illustrates how the system works in the northern-coast village of Goveo (Palmer 2002a:137). Kokota illustrates the typical situation we have described for Oceanic languages: a set of four directionals de²nes four absolute directions, thus dividing the horizontal plane into four quadrants. The latter commonly serve to locate people or things in space, whether they are static or dynamic, and whatever the scale: for example, ‘we’re going in the fona-direction to her village’, or ‘my cookhouse is on the rauru-side of your house’ (Palmer 2002a:154), and so on.

2.1 A TYPOLOGICAL LOOK AT SPACE REFERENCE SYSTEMS. Referring linguistically to space essentially consists in using words to help the addressee mentally construct a vector. This vector may be of two kinds. In some cases, it stands for the itinerary actually followed by a theme in motion, like in They were climbing UP the tree; Your dog’s FOLLOWING my car; She’ll COME tonight. In other cases, the vector represents a mental path, usually the one that links the speaker to a theme, regardless of whether or not the latter is in motion: They were singing UP in the tree; Your dog’s BEHIND my car; She’ll be sitting right HERE. In either case, whether the reference is dynamic or static, the principles are basically the same: the speech context must display certain bearings, easily identi²able for both the speaker and the addressee, accessible to their senses or memory, to form the geometrical basis for the construction of the vector. These bearings may be of any kind: the closest hill, a moving dog, a motionless sofa; most of them will be unique to a speci²c context, and thus expressed by proper place names, or by lexical material (like Eng. beach). But some landmarks are so frequent in speech that they eventually grammaticalize: a typical example is when the location of the speaker becomes morphologized into deictic markers, for example, demonstratives (this), adverbs (here), directionals (hither), or even verbs (come). Other examples are possible and indeed widespread, such as when the difference in vertical height is the source for such common morphemes as up and down; or when certain body parts (e.g., the face, the backside, the right and left hands) end up morphologized into spatial markers, through processes of metaphor or metonymy (Svorou 1994). It would certainly form the basis for rich cross-linguistic research to study which landmarks are most often grammaticalized among human languages: some could probably claim the status of typological universals, like the reference to the speech coordinates (deixis), or the use of the vertical axis, as we have just suggested. On the contrary, certain types of strategy that were once taken for granted as being universal have recently been found to be absent from certain language families: to take a crucial example, the use of the right/left contrast for space-referring purposes appears to be unknown in Tenejapa (Brown and Levinson 1992), in Guugu Yimidhirr (Haviland 1993), as well as—closer to us—in most Oceanic languages (Senft ed. 1997). Likewise, it is common in many languages, including those of Europe, to encode certain horizontal vectors by resorting to an implicit projection of the human body onto certain objects, whether these anthropomorphical coordinates are centered in the object itself—for example, the ball is TO THE LEFT of the car, where the car is intrinsically oriented—or emanate from an observer’s viewpoint—for example, the ball is TO

4

oceanic linguistics, vol. 43, no. 1

FIGURE 1. THE FOUR DIRECTIONS OF THE NORTHERN KOKOTA SYSTEM

paka

SANTA ISABEL

rauru

N

fona

rhuku

Compared with our cardinal compass points, the whole structure is rotated by several degrees. To be precise, it is impossible to say in which direction this rotation takes place: this could only make sense if we knew which of the four directions is supposed to match, say, our ‘north’. The comparison between Oceanic geocentric systems and European compass points must be made with precaution. 2.3 LAND/SEA VS. CARDINAL AXIS. Now, what seems to be a straightforward situation appears to become more and more complex as one changes the scale of observation from one village to a whole island, from one island to a group of islands, and from one language to another. At ²rst sight, the two orthogonal axes of ²gure 1 resemble each other in form and in function. Yet, if compared with a standard European-like cardinal system, a paradox appears as one moves to another village speaking the same language. If we cross the island of Santa Isabel and go from Goveo on the northern coast, to Hurepelo on the southern coast, we realize the rauru–rhuku axis has been reversed in cardinal terms, while the paka–fona remains identical (Palmer 2002a:137). This situation is illustrated in ²gure 2. FIGURE 2. THE TWO AXES OF KOKOTA: ONE FIXED, ONE VARIABLE

the geocentric system of proto-oceanic

5

The language of Mwotlap shows exactly the same con²guration (François 2003:417): one direction (hay, cf. Kok rhuku) points toward the watershed of the territory, while its opposite (yow, cf. Kok rauru) designates either side of the island; conversely, a second pair of directionals (hag–hôw) appears to be insensitive to the topography of the island, with hag roughly pointing ENE, and hôw WSW. Structurally speaking, the geocentric systems of these two languages are perfectly identical; the only difference is that the one used on the island of Mwotlap appears to be pivoted by about 50° counterclockwise when compared with Kokota (but see 3.4.1). Certain non-Oceanic languages, like Balinese, show a similar system (Adelaar 1997:57). The situation in Kokota and Mwotlap will help us set forth the basic principles of our cross-Oceanic study. If we take, say, the system of ²gure 1, the two geocentric axes can be said to form a balanced system, at least when considered within a particular setting; yet ²gure 2 shows these two axes to be established along totally different principles. One pair of directionals contrasts ‘inland’ (Kok. rhuku, Mwt. hay) with ‘seaward’ (Kok. rauru, Mwt. yow), and is thus tightly bound to the perceptible declivity of the landscape; its orientation, in cardinal terms, necessarily varies according to which side of the island one is on, and to the general orientation of the shoreline. On the contrary, the second pair of directionals appears to be essentially ²xed in compass terms—at least within one language community—and does not depend on any feature of the local topography: for example, in Kokota, fona will always indicate the southeastern quadrant, and paka the northwestern. To be precise, only the latter pair of directionals can be said to de²ne a “cardinal axis” in the strict sense of the word—because the land-sea contrast cannot be assigned any regular direction in compass terms. From now on, any pair of directionals sharing the properties of paka–fona in Kokota (i.e., relative ²xedness in compass terms) will be designated as the cardinal axis of the system. The situation we have just described for Kokota and Mwotlap is encountered in most modern Oceanic languages: on the one hand, a land-sea axis whose cardinal position varies according to the orientation of the shore; on the other hand, a cardinal axis that is essentially ²xed in compass terms. It is the purpose of this paper to discuss the precise nature and motivation of these two axes in Oceania, and to propose hypotheses regarding their historical development.

N

RAURU

3. AN OVERVIEW OF MODERN OCEANIC SYSTEMS

paka

paka

RAURU

fona

RHUKU

fona

SANTA ISABEL

3.1 OUR LANGUAGE SAMPLE. In order to conduct our cross-linguistic comparison, we have selected a sample of sixteen Austronesian languages. Obviously, the ²rst requirement in establishing this sample was that a reliable description for each language’s space reference system—albeit brief—should be available. A second principle, in order to get a representative picture of the Oceanic family, has been to select languages as diverse as possible, both on geographic and on genetic grounds, so that all important groups and subgroups of Oceanic are represented. Also, two non-Oceanic languages have been added to the list, for the sake of external comparison: Balinese, which is quite remote from Oceanic in the Austronesian family tree; and Taba, a lan-

6

oceanic linguistics, vol. 43, no. 1

the geocentric system of proto-oceanic

7

guage that is conversely very close, and should help assess the degree of innovation— or lack thereof—of Proto-Oceanic on the issue of geocentric reference. We list here these sixteen languages in geographical order, roughly from West to East, with the indication of their country of location, followed by a tag for their genetic subgrouping:2 non-Oceanic: Balinese (Indonesia, wmp); Taba (Indonesia, shwng); Oceanic: Saliba (Papua New Guinea, pt); Yabêm (PNG, nng); Kokota (Solomon Is., mm); Kwaio and Longgu (Solomon Is., ses); Mwotlap and Northeast Ambae (Vanuatu, ncv); Anejoü (Vanuatu, sv); Nemi, Xârâcùù, and Iaai (New Caledonia, nc); Pohnpeian (Micronesia, mic); Samoan and Marquesan (Polynesia, cp). Figure 3 presents a genetic tree of the Oceanic family, locating each language of the sample in its own subgroup (after Ross, Pawley, and Osmond 1998); it does not detail the stages above Oceanic, nor those below Central Paci²c. Throughout this cross-linguistic presentation, we examine data that are detailed in our bibliographical references; our sources are listed in the appendix. We have compiled the main information in a comparative chart (table 1), to which we regularly refer in the following pages. (Square brackets enclose our personal comments or additions, as compared with the corresponding bibliographical reference.) Sections 3.2 to 3.4 comment on the data and on the varied issues presented in table 1.

3.2 THE LAND/SEA AXIS. As one could expect, the sixteen languages of the sample show both similarities and differences. First and foremost, it is important to note that all of them possess some kind of absolute reference system to which they ordinarily resort for the encoding of horizontal vectors. This geocentric system always combines with at least one pair of directionals for the vertical axis (up–down). One important characteristic shared by all the languages of the sample—and probably by all Oceanic languages—is that one axis of the system is de²ned by a contrast between inland and seaward. This land/sea axis is orthogonal to the shoreline, and thus essentially varies with the orientation of the latter, as was illustrated in ²gure 2. The

FIGURE 3. THE LANGUAGES IN OUR SAMPLE, ORGANIZED GENETICALLY (Western Malayo-Polynesian … ) (Eastern Malayo-polynesian … ) South Halmahera–West New Guinea oceanic Admiralties Western Oceanic Papuan Tip North New Guinea Meso Melanesian Eastern Oceanic Southeast Solomonic Remote Oceanic New Caledonian n. New Caledonia s. New Caledonia Loyalties Southern Vanuatu North-Central Vanuatu Eastern–Outer Islands Micronesian Central Pacific Fijian Polynesian

→ Balinese → Taba

→ Saliba → Yabêm → Kokota → Longgu, Kwaio → → → → →

Nemi Xârâcùù Iaai Anejoü Mwotlap, Ambae

→ Pohnpeian → Samoan, Marquesan

2. Our abbreviations for language subgroups follow the usages on this matter: WMP (Western Malayo-Polynesian), SHWNG (South Halmahera North New Guinea), PT (Papuan Tip), NNG (North-New Guinea), MM (Meso-Melanesian), SES (South-East Solomonic), NCV (North-Central Vanuatu), SV (South Vanuatu), Loy (Loyalty Is.); NC (New Caledonian), Mic (Micronesian), Pn (Central Paci²c: Polynesian).

TABLE 1. THE GEOCENTRIC DIRECTIONAL SYSTEM IN SIXTEEN AUSTRONESIAN LANGUAGES: LAND/SEA AXIS, CARDINAL AXIS, TRAVERSE AXIS land-sea etyaxis mology

cardinal axis

etymology

orientation

motivation

cals†

utls‡

Balinese WMP

-aja ~ -lod

land ~ sea

-auh ~ -a¥in

(?) ~ wind

→ east

monsoon

+

–

Taba SHWNG

le ~ la

land ~ sea

ya ~ po

up ~ down

→ south [-east]

?

–

no

Saliba PT

sae ~ dobi

up ~ down

sae ~ dobi

up ~ down

→ east

sun [?]

–

lao

Yabêm NNG

-sô ~ -sa

in ~ out

-pi ~ -sêp

up ~ down

→ west

[*sun]

+

–

Kokota MM

rhuku ~ rauru

(?) ~ (?)

fona ~ paka

(?) ~ (?)

→ [south-] sun [?] east

+

–

Longgu SES

longa ~ asi

[bush] ~ sea

ala‘a ~ toli

[up ~ down]

→ [south-] sun [?] east

+

–

Kwaio SES

fataia ~ asi

bush ~ sea

‘ala‘a ~ ‘aisifo

up ~ down

→ southeast

?

+

?

Mwotlap NCV

hay ~ yow

in ~ out

hag ~ hôw

up ~ down

→ southeast

wind

+

–

Ambae NCV

hage ~ hivo

up ~ down

hage ~ hivo

up ~ down

→ southeast

wind

–

vano

Anejoü SV

-pahai ~ -þok

(?) ~ (?)

-jai ~ -se(h)

up ~ down

→ southeast

?

+

–

Xârâcùù NC

axwè ~ anä

up ~ down

axwè ~ anä

up ~ down

→ southeast

wind

–

akwèè

Nemi NC

-da ~ -dic

up ~ down

-da ~ -dic

up ~ down

→ southeast

wind

–

-en

Iaai Loy

-iö ~ -ü

[up ~ down]

-iö ~ -ü

[up ~ down]

→ east

sun [?]

–

-lee

Pohnpeian -long Mic ~ -ei

bush ~ sea

-dak ~ -di

up ~ down

→ (windward)

wind

?

?

Samoan Pn

bush ~ sea

i sasa‘e ~ i sisifo

up ~ down

→ east

?

?

?

bush ~ sea

‘i ‘uka ~ ‘i ‘a‘o

up ~ down

→ east

wind

–

‘i kô

i uta ~ i tai

Marquesan ‘i uta Pn ~ ‘i tai † ‡

cals = Cardinal Axis used on Local Scale. utls = Undifferentiated Traverse axis used on Local (and navigational?) Scale.

8

oceanic linguistics, vol. 43, no. 1

reason for privileging the shoreline as a central landmark is easily accounted for by the ecological context in which Oceanic populations live: most of them dwell in coastal villages on scattered smallish islands, and literally live off the sea. Incidentally, this spectacular deterministic correlation between cultural ecology and language structures is in itself worthy of acknowledgment. However, languages differ as to how this land/sea axis is lexi²ed (see table 1): • Kokota and Anejoü use terms whose etymology is not given in the data, or which seem to have no meaning in the language other than this directional reference; • locative phrases, often originating in noun phrases such as (to) bush ~ land vs. (to) sea, are apparently used in Balinese, Taba, Kwaio, Longgu, Pohnpeian, Samoan, and Marquesan; • up vs. down are used in Saliba, Ambae, Xârâcùù, Nemi, and Iaai; • in vs. out are used in Yabêm and Mwotlap, and outside our sample, in MangapMbula (Bugenhagen 1995:378). The reason for the last two cases is easy to understand. In languages like Saliba, the movement of going toward the shore/sea is essentially perceived as a downward motion (which it obviously is, even if the slope is sometimes very gentle). In languages like Mwotlap, the same movement is perceived as an outward motion, as if the island were perceived as a containing ²gure, the outside of which would be the surrounding sea (François 2003:425). In Longgu, the seaward direction is reportedly bounded by the shore (Palmer 2002a:123, after Hill 1997:116). But in other languages such as Mwotlap, this directional can extend far out to sea and point to the deep ocean; symmetrically, the inland direction commonly designates the island for somebody who is at sea. Therefore, in New Caledonian languages (Ozanne-Rivierre 1997), it is common for people at sea to say ‘Let’s paddle up (toward the shore)’ or ‘Let’s paddle down (further toward the deep sea)’, even if, of course, no vertical motion is involved. 3.3 THE CARDINAL AXIS. In all Oceanic languages, the above mentioned land/sea axis is crossed by a second axis that is orthogonal to it, and hence necessarily parallel to the shoreline; the nature of this cross axis is diverse, and will be examined in 3.4. But before this, let us provisionally change the scale of observation, and switch from the narrow context of a village/a valley/a small island—that is, the “local scale”—to the context of seafaring and inter-island distances—what can be called the “navigational scale” (Palmer 2002a:131). Even when they seem to follow an isolated way of life that is apparently con²ned to a village or a small area, Oceanic populations always preserve some sort of trade and cultural relations with each other, both from one valley to another across large islands (e.g., New Caledonia’s mainland), and from one island to another across the Paci²c ocean. Referring to space in this broader context cannot be done along the same principles as in the local scale—if only because the land/sea axis becomes irrelevant whenever a ship at sea temporarily loses sight of any land. As far as this navigational scale is concerned, Oceanic systems turn out to be remarkably consistent. They all make use of a single unbounded axis, relatively

the geocentric system of proto-oceanic

9

²xed in cardinal terms, which we call the cardinal axis. As it consists of one pair of directionals X–Y, the axis used on the navigational scale essentially amounts to dividing the world not into four quarters, but into two halves: starting from any point in space, the cardinal axis will make it possible to de²ne one side as the ‘X side’, the other side as the ‘Y side’. This cardinal axis X–Y, which is found throughout Oceania in various forms, raises three questions. First, are Oceanic languages also consistent in the way the axis is being lexi²ed? Second, can we de²ne its orientation in cardinal terms? Third, what is the historical motivation of this axis? 3.3.1 How is the cardinal axis lexi²ed? If we bring together the information that is scattered among the different language descriptions, we discover a spectacular case of convergence: every language in Oceania makes use of a cardinal axis in the navigational scale, and this axis is everywhere encoded by a pair of vertical directionals meaning up and down. In our sample, this is true of virtually all languages: Taba, Saliba, Yabêm, Longgu, Kwaio, Mwotlap, Ambae, Anejoü, Xârâcùù, Nemi, Iaai, Pohnpeian, Samoan, Marquesan. The relevant forms are listed in the third column of table 1. Incidentally, this use of up–down for this cardinal axis causes homophony with the land–sea subsystem (3.2) in several languages (Saliba, Ambae, Xârâcùù, Nemi, Iaai). To be true, there are a few reasons why this remarkable cross-Oceanic consistency may have been obscured. First, the modern forms for up–down are not cognate throughout the family, as several languages have gone through processes of lexical innovation; yet, for most of them, any change in the vertical directionals has been transferred to the cardinal axis, so that the perfect match between both dimensions is preserved language-internally. Second, for certain languages, only the pair of forms X–Y is cited in our sources, with no clear mention of their homophony with the vertical directionals. This can happen either because the description is not detailed enough, or because local evolutions have eventually obscured the etymology of these words—in the latter case, the vertical and the cardinal axis will have lexically diverged through time. But even when this happens, it is sometimes possible to trace back the original meaning of X–Y as being up–down: for instance, our discussion in the appendix will suggest that this was indeed true for the two forms of Iaai iö–ü, although their vertical meaning has now been taken over by other morphemes; see also the discussion on Longgu ala‘a–toli. Only two cases remain to be clari²ed: ²rst, our documentation says nothing about the etymology of the Kokota terms paka– fona (²gure 1), although we suspect them to be connected respectively with ‘down’ and ‘up’; the other case is external to Oceanic, and concerns Balinese: the form -a¥in is cognate with the root for ‘wind’, not ‘up’. But this does not affect the general observation that all known Oceanic languages make use, on the navigational scale, of a cardinal axis coded up–down. In certain languages (e.g., Ambae, Saliba, Iaai), this single cardinal axis is also reported to be orthogonally crossed by a traverse axis, the two sides of which are not differentiated. This traverse, which can be glossed across, serves to encode those directions that are neither clearly up nor down in the cardinal system (see ²gure 4).

10

oceanic linguistics, vol. 43, no. 1

Other languages lack this cross axis on the navigational scale (e.g., Mwotlap, Nemi); on the issue of traverse axes, see 3.4.2.

the geocentric system of proto-oceanic

11

3.3.3 Historical motivation for the cardinal axis. The question of what motivates this up–down axis is a controversial matter. The descriptions of Saliba, Kokota, Longgu, and Iaai propose to draw a relation with the path of the sun. Indeed, the words (go) up and (go) down are regularly used in sentences having the sun as their subject,

and meaning respectively (sun)rise and (sun)set; it sounds logical to infer from this an equation up = East and down = West (Osmond 2000:22)—see the etymology of Latin oriens < oriri ‘rise’ and occidens < occidere ‘fall down’. Furthermore, this path-of-thesun hypothesis is sometimes proposed by the informants themselves (Hill 1997:106). Despite its intuitive appeal, we are not totally convinced by this interpretation; we have already discussed it in detail in François (2003), and will just summarize our argument here. For a language to use the same term for ‘go up’ and ‘(sun)rise’ is no surprise, and would be expected. But what does seem hard to understand, is how a language could possibly say I am going up(ward) when what is meant would be ‘I am going toward the place where the sun regularly goes up’; the semantic likeliness of such a shortcut would be questionable, as going eastward wouldn’t really give anybody the feeling of ascending. Another argument against the sun hypothesis is the diversity of the actual directions that are attested for this up–down axis, both across languages (see 3.3.2) and within a single language (François 2003 for Mwotlap): how could the sunrise possibly provide the motivation for a cardinal axis that is most often oriented due southeast, sometimes due south, sometimes southwest or even due west? An alternate hypothesis would propose to see a link between the up–down axis and the path of the prevailing winds. Indeed, in the southern hemisphere where most Oceanic languages are spoken, the trade winds generally blow from southeast toward the equator most of the year. The knowledge and mastery of these meteorological phenomena notoriously played a crucial role in the history of the Austronesian sailors who peopled the Paci²c Ocean (Lewis 1972, Irwin 1992, Osmond 2000). For such a salient feature of the environment to have become systematized in their navigational system is not that surprising—even if, once again, the interplay between historical culture and linguistic structures indeed deserves admiration. Following this hypothesis, the vertical direction (go) up in Oceanic languages would receive a secondary meaning ‘against the wind’, while its counterpart (go) down would be used to mean ‘following the wind’. This makes sense if one considers that a ship sailing into the wind may give its crew the feeling of walking ‘up’ a steep slope, whereas a ship that is being pushed astern somehow makes people feel they’re sliding ‘down’ a slope (Françoise Ozanne-Rivierre, pers. com.). Incidentally, English makes the same metaphor when it contrasts upwind with downwind; this alone should con²rm the semantic likeliness of our interpretation. The trade-wind hypothesis has been proposed by several scholars to account for the up–down axis in several Oceanic languages, for example, Lavondès (1983) for Marquesan; Ozanne-Rivierre (1997:85, 1999:86) for several languages of Polynesia and of New Caledonia;4 Hyslop (2001:216) for Northeast Ambae; François (2003:433) for Mwotlap. In fact, the importance of the winds for navigational and space-referring purposes is acknowledged even by those authors who otherwise resort to the sun when accounting for the up–down axis (Ross 1995; Osmond 2000). We will come back to this issue in our section about Proto-Oceanic (4.2).

3. That Mwotlap’s cardinal axis is oriented southeast seems in contradiction with what we said in 2.3 (“land/sea vs. cardinal axis”), when we brie³y compared it with Kokota. This paradox, which is due to the difference between scales, will be explained in 3.4.1 (see also François 2003).

4. Drehu makes use of two cardinal axes: it seems to have innovated a cardinal axis based on the sun, in combination with the ²rst wind-based axis (Moyse-Faurie 1983:79; Ozanne-Rivierre 1997:92).

3.3.2 How is the cardinal axis oriented? Also remarkable is how consistently this up–down axis is oriented throughout Oceania. Roughly speaking, up almost systematically points southeast, while its counterpart down designates the northwestern half of space. This NW/SE orientation is explicitly established in the description of Kwaio, Mwotlap,3 Ambae, Anejoü, Xârâcùù, and Nemi. In several cases, although the empirical data—often supported by geographical maps—do show this NW/SE orientation, the describer still chooses to gloss the axis with the terms “east” and “west.” Such a translation seems to be adopted essentially for the sake of reading convenience, and also because a comparison is often implicitly presupposed with European-like systems, in which the sun plays the major part (see 3.3.3). This distortion of the empirical facts, which can eventually mislead the analysis, is sometimes obvious in the way the data are presented, as in the case of Kokota: “paka = west (i.e., toward sunset), fona = east (i.e., toward sunrise). The east–west axis runs northwest–southeast somewhat less than 45° off cardinal east–west” (Palmer 2002a:153). In this instance, the 45° rotation of the so-called “east–west” axis is assigned to the physical orientation of the shoreline of Santa Isabel, which indeed happens to be oriented NW/SE. However, in the present stage of our investigation, as we do not wish to take any interpretation for granted, we prefer to stick to the observable data, and gloss these two directionals respectively paka ‘northwest’ and fona ‘southeast’ (see ²gure 2). Incidentally, this is also what the same author chooses to do elsewhere (Palmer 2002b:517). A similar discussion is required for Longgu, where the gloss “east–west” apparently stands for what is in fact southeast/northwest (see the appendix), and the map provided for Taba’s navigational scale (Bowden 1997:264) also suggests the same SE/ NW orientation, even if it is not explicitly described this way. Otherwise, certain systems do appear to be oriented more clearly eastward. This is true for Balinese, Saliba, Iaai, Samoan, and Marquesan. The data for Pohnpeian give no other orientation for -dak (‘up’) than ‘windward’, and we are not sure to what cardinal direction this should correspond. Finally, the strangest exception is that of Yabêm, which apparently uses ‘up’ (-pi) to encode for due west. For all these speci²c discussions, see the appendix. To sum up, our Oceanic sample shows eight cardinal axes to be oriented due southeast, four to be eastward, one westward; the southeastern pattern is clearly predominant. The orientation of each cardinal axis (taking the up-term as the reference) appears in the column headed by “orientation” in table 1.

12

oceanic linguistics, vol. 43, no. 1

3.3.4 Summary. To recapitulate this section, we have shown that Oceanic languages typically encode long-distance relations—either across a large island, or across the sea—by resorting to a single cardinal axis; it is always lexi²ed up–down, with the direction up pointing generally east or southeast. The geographical orientation of this axis (NW→SE), as well as the use of a vertical metaphor, is probably best accounted for if the trade winds are seen as the source of this cardinal axis: hence, the most accurate gloss for up vs. down here is ‘upwind’ vs. ‘downwind’. Finally, some languages add to this cardinal axis an undifferentiated traverse glossed across. Figure 4 illustrates the navigational-scale system characteristic of modern Oceanic languages. 3.4 AN AXIS PARALLEL TO THE SHORELINE? So far, we have been able to observe remarkable consistency between the geocentric systems of modern Oceanic languages, in two respects: ²rst, they all employ a land/sea axis on the local scale; second, they all employ a wind-based cardinal axis on the navigational scale. Obviously, these two spectacular cases of convergence will be of great help in our attempt to reconstruct the system of Proto-Oceanic (section 4). If we now come back to the local scale, we can observe a third similarity between all languages: that is, the existence of a secondary axis orthogonal to the land/sea axis on land. Its function is to help construct those space vectors that belong neither to the seaward, nor to the inland quadrant; and because this cross axis is perpendicular to the land/sea axis (which itself is orthogonal to the coast), it necessarily runs parallel to the shoreline. Now, the languages of our sample appear less unanimous if we pay attention to the detail of that secondary axis on land. Basically, all languages fall into one of two utterly different systems: either the axis parallel to the shore coincides with the cardinal axis; or it is an undifferentiated traverse. 3.4.1 The cardinal axis on land. On the face of it, the ²rst con²guration is not dif²cult to present, because it simply consists in combining the two axes we have just examined. On the local scale, the land/sea axis (3.2) is crossed by an up–down cardinal axis (3.3), which is the same as the one that is employed on the navigational scale. FIGURE 4. A TYPICAL NAVIGATIONAL-SCALE SYSTEM IN OCEANIA: ONE CARDINAL AXIS CODED UP–DOWN AND ORIENTED [SOUTH]EAST DOWN ‘downwind, toward [north]west’

(across) N

(across)

UP ‘upwind, toward [south]east’

the geocentric system of proto-oceanic

13

An illustration of such a system was already presented in 2.3: in Kokota, the cardinal axis running from NW (paka) to SE (fona) is ordinarily used as much on land as at sea, and combines with the land/sea axis (rhuku–rauru) so as to form a balanced, four-quadrant system of absolute reference (²gure 2). In our sample, the other languages that exemplify this pattern are Balinese, Yabêm, Longgu, Kwaio, Mwotlap, and Anejoü; they are indicated by a ‘+’ sign in the penultimate column of table 1, under the mention cals. (Cardinal Axis used on Local Scale). Despite its relative simplicity, this type of geocentric system raises a real problem, which the reader will probably have thought of already. How can we possibly claim that one and the same axis is both “parallel to the shore” and is a “cardinal axis,” which normally means ²xed in space? The case of Kokota (²gure 2) is somewhat an ideal case, as the shoreline is oriented NW–SE on both sides of Santa Isabel, hence matching exactly the (probable) orientation of the cardinal axis used at sea.5 But what happens if the shoreline is oriented in a direction that is different from the language’s cardinal axis? This type of con³ict is probably better exempli²ed by the case of Mwotlap (François 2003:429), because the island of Mwotlap—also known as Motalava—is geographically oriented WSW–ENE. In order to ²nd out the proper orientation of the cardinal axis in this language, one needs ²rst to ignore the context of any speci²c landscape, and observe how the language behaves on the navigational scale, as this is the only instance where no shoreline imposes its own orientation; it then becomes clear that the prototypical value of hag ‘up’ in Mwotlap is due southeast—which (on that scale) implies the whole southeastern half of space. But as one narrows down the observation to the local scale of Mwotlap Island, one realizes that the very same up direction is not pointing southeast any more, but east-northeast. The cardinal axis has thus been rotated up to 80° counterclockwise from its prototypical value, so as to follow closely the direction of the principal shoreline. However remote it is from due southeast, the ENE direction nonetheless still belongs geometrically to the southeastern hemisphere, which is enough to encode it as ‘up’. In summary, whenever the cardinal axis must be used on land, it has to undergo an adaptive process so as to become parallel to the shoreline; yet its orientation on land cannot be pivoted more than 90° from its navigational value, so as to preserve the consistency of the overall system. At least, this is how Mwotlap—and probably other similar Oceanic systems—could solve the paradox we were mentioning above, that of an axis being both “²xed in space” (within 90° on each side!) and bound to the shore’s orientation. To summarize, the languages that employ the cardinal axis on land make it necessary to distinguish between two scales: 5. Strangely, this convergence between a language’s cardinal axis (due to the path of the trade winds blowing nw–se) and the predominant orientation of its island (due to geological activity) is frequent throughout island Melanesia. This coincidence concerns the islands of Bougainville, Choiseul, Santa Isabel, Guadalcanal, Malaita, San Cristobal (Solomon Is.), Espiritu Santo, Maewo, Pentecost, Malekula (Vanuatu), as well as New Caledonia’s Mainland, and so on. Such landscape con²gurations may make it less likely for the ²eldworker to observe the kind of adaptive processes we were confronted with in the case of Mwotlap.

14

oceanic linguistics, vol. 43, no. 1

• on the navigational scale, the cardinal axis is the only one relevant—except for a neutral traverse which is sometimes derived from it (²gure 4). Being free from any other constraint, this axis directly points toward the system’s cardinal up (i.e., upwind), dividing space into two halves; • on the local scale, the same cardinal axis combines with the land/sea axis, so as to divide space into four balanced quadrants. Although this cardinal axis on land continues to roughly designate the same region as it does at sea, it is subject to a rotation within 90° in order to meet the main orientation of the shoreline. The resulting twofold system is represented in ²gure 5. Initials SE represent Southeast; the down direction is not mentioned, as it is simply symmetrical to up. 3.4.2 The undifferentiated traverse axis. Despite being well attested, the system illustrated in ²gure 5 is not the only one in Oceania; all the remaining languages in our sample belong to a second type, structurally quite different. Although these languages do possess a full up–down cardinal axis just like others, they restrict its use to the navigational scale, that is, across valleys or across the sea. As far as the local scale is concerned, for example, within a village or a valley, this cardinal axis is irrelevant; instead, what crosses orthogonally the land/sea axis is a “traverse axis” that runs parallel to the shore. And contrary to the cardinal axis, this traverse does not distinguish between its two sides, hence its name of undifferentiated (or unoriented) traverse axis. If we take the example of Marquesan, we thus observe a land/sea axis that explicitly makes the difference between ’i tai ‘to the sea’ and ’i uta ‘to the bush’; and a secondary traverse characterized by a single directional ’i kô on each side. The latter form is sometimes glossed ‘across’, and must be understood ‘on a direction parallel to the shore’. Structurally speaking, this form is ambiguous, as it does not distinguish between the two sides of the shore; in a way, it can be said to simply obey a negative de²nition, that is, ‘neither seaward nor landward’. Evidently, this type of traverse is exclusively de²ned by its relation to the axis to which it is orthogonal (in this case, the land/sea axis); geometrically speaking, the former is therefore necessarily derived from the latter (Palmer 2002a:130). A corollary of this point is that traverse axes have no reality of their own outside the localscale system, and therefore they do not require the same adaptive type of mechanism as we saw in the case of the cardinal axis (3.4.1).

the geocentric system of proto-oceanic

15

This system is attested throughout our sample: in Taba, Saliba, Ambae, Xârâcùù, Nemi, Iaai, Marquesan—see also Mosel (1982) for Tolai (New Britain), and Palmer (2002a:132) for a general presentation of traverse axes.6 In table 1, these languages are indicated negatively in the penultimate column, because they do not make use of the cardinal axis on land (cals)—and positively in the last one (utls: ‘Undifferentiated Traverse used on Local Scale’). In this case, the form of the directional is given. When a language possesses the same sort of undifferentiated traverse on its navigational scale (see 3.3.1), it lexi²es it the same way as on the local scale—for example, lao in Saliba, vano in Ambae, -lee in Iaai. In Marquesan, although the directional ‘i kô is restricted to the local scale, the verb taha ‘walk, pass by’ can be used on any of the two scales: besides designating a direction parallel to the shore on the local scale, it also regularly points to the north-south axis, that is, directions that are neither eastward (hiti ‘go up’) nor westward (heke ‘go down’). Figure 6 illustrates the systems characterized by an undifferentiated traverse axis on land. The distinction between the two scales appears to be here even more necessary than in ²gure 5 above. 3.4.3 A note on circular systems. To be precise, a third con²guration is also attested, but has only been described, to our knowledge, for three Austronesian languages: Manam (Lichtenberk 1983: 572), Boumaa Fijian (Dixon 1988:88), and the “intermediate-scale orientation” of Makian Taba (Bowden 1997:262). These systems possess a differentiated axis X-Y, but instead of designating a portion of space that would be ²xed in compass terms—as is the case for cardinal axes—each form encodes a direction parallel to the coast around a small island, either clockwise or counterclockwise. The three languages cited lexify these “circular directionals” using terms borrowed from the vertical axis, but they are not consistent with each other: Manam ra¿e and Boumaa ca’e con³ate ‘up’ and ‘clockwise’, whereas the Taba root ya covers both ‘up’ and ‘anti-clockwise’. FIGURE 6. SOME MODERN SYSTEMS USE AN UNDIFFERENTIATED AXIS ON THE LOCAL (AND SOMETIMES THE NAVIGATIONAL) SCALE inland (across)

FIGURE 5. SOME MODERN SYSTEMS USE THE CARDINAL AXIS BOTH ON NAVIGATIONAL AND ON LOCAL SCALES

across

across (across)

inland seaward UP [-wind] (e.g., SE ± 90°)

local scale UP [-wind] (e.g., SE)

seaward

local scale

navigational scale

UP [-wind] (e.g., SE) navigational scale

6. A linguistic survey we conducted in the Banks group (northern Vanuatu) in 2003 has shown us that the four languages of Vanua-Lava possess the same system as Mwotlap, whereas the ²ve languages of Gaua, together with Mwerlap and Mota, follow the traverse-axis system (François, pers. data).

16

oceanic linguistics, vol. 43, no. 1

This contradiction between languages, as well as the paucity of attested cases, makes it probable that these three circular systems have arisen separately, possibly after the up–down cardinal axis on one side of an island was eventually extrapolated to its other side. Despite the intrinsical interest of these clockwise systems for typological research (Palmer 2002a:138), it is not likely that they re³ect the characteristics of their common ancestor, being instead the result of parallel—and partly diverging—innovations. This is why they were not included in table 1, and are only mentioned here for the sake of comprehensiveness. 3.5 CONCLUSION. Based on the linguistic information listed in table 1, the last section has presented the two principal types of geocentric system that are attested among modern Oceanic languages; they are illustrated by ²gures 5 and 6. Their main difference lies in the nature of the axis that is used on the local scale, orthogonally to the land/sea axis and hence parallel to the shoreline. In addition to this central parameter, other characteristics were seen to differ from language to language, such as (1) the way the land/sea contrast is being lexi²ed, (2) the existence of a traverse axis on the navigational scale, and (3) the precise orientation of the cardinal axis in compass terms. But if we set aside these small differences, what dominates the whole picture is probably the profound homogeneity of all Oceanic languages on the topic of geocentric space reference. This relative unity is a strong encouragement toward reconstructing the system of the common ancestor of this family. 4. THE GEOCENTRIC SYSTEM OF PROTO-OCEANIC. We try here to formulate a uni²ed historical hypothesis about the organization of absolute space reference in Proto-Oceanic. Obviously, some features were inherited from even earlier stages (see Blust 1997 for PMP, and the data from Balinese and Taba in table 1); but we will leave this question aside, and concentrate on the stage of POc. Also, we shall not be concerned with the reconstruction of new lexical forms, but rather with the mechanics of a system; as far as the lexical and syntactic reconstructions are concerned, we will generally refer to Ross (1995; 2004), and other references therein. 4.1 PROTO-OCEANIC ON LAND. A ²rst reasonable hypothesis is to attribute to POc the features that are common to all Oceanic languages, according to our sample. One can therefore take it for granted that Proto-Oceanic made an extensive use of absolute spatial reference in order to code horizontal relations. If POc speakers were talking on dry land, or with reference to a speci²c island, they employed an axis perpendicular to the coast, running from the watershed, or (what was conventionally considered as) the middle of the island, down toward the shore, and probably even toward the deep ocean. Concerning the question of how this axis was lexi²ed (3.2), observation of the modern data shows two patterns to be widespread across the family: one resorts to vertical ‘up’ vs. ‘down’, the other uses forms that were originally nouns or locative nouns, such as ‘bush’ or ‘sea’. In actual fact, it is not indispensable to choose between these two hypotheses for POc, as they are compatible with each other. The land/sea axis was most probably referred to

the geocentric system of proto-oceanic

17

using the two verbs for vertical axis: *sake ‘go upward’ and *sipo ‘go downward’; and these verbs would be often reinforced by prepositional phrases like *sake i qutan ‘go up to the bush’ and *sipo i laur ‘go down to the shore’ or *sipo i tasik ‘go down to the sea’ (Ross 2004). It is probable, though still unsure, that the two verbs could also be employed by people on a boat, with reference to a nearby shore, with the meanings *sake ‘sail/paddle toward the island’ and *sipo ‘sail/paddle away from the island, toward the deep sea’. Getting back on land, the land/sea axis we have just de²ned was obviously crossed by an orthogonal axis, parallel to the shore; the question arises whether the latter was an “undifferentiated traverse,” or was oriented on each side. This is not an easy question in terms of the comparative method, as both schemes are well represented in all subgroups of the family. All things considered, several arguments tend toward the ²rst possibility, namely, that POc made use of an undifferentiated traverse on the local scale. Indeed, in modern languages, every time the axis parallel to the shore is oriented, it coincides with the cardinal axis used on the navigational scale. In other words, the system with only two axes (land/sea + cardinal: see ²gure 5) always results from the simpli²cation of a more complex system based on three axes (land/sea + traverse + cardinal: see ²gure 6), once the local traverse has been lost (5.4). Furthermore, the traverse axes attested throughout the different subgroups of Oceanic often share the same etymological meaning, that of a neutral verb of movement ‘go (neither up nor down)’: Saliba lao, Ambae vano, Nemi -en, and so forth. Two of these forms, vano and probably -en (< Nemi hen ‘go’), come from POc *pano, which is precisely reconstructed by Ross as the third term in a triplet *sake : *sipo : *pano: “It seems that *pano (‘go away [from speaker], depart’) was also used as a geographic direction verb meaning ‘move in a transverse direction, move across the valley’. In this sense it contrasted with ‘go up, go inland’ and ‘go down, go seaward’. The two different uses of *pano are reconstructable for POc” (Ross 2004:302). Although other candidates are also conceivable (e.g., POc *lako ‘go’ > Saliba lao), we follow Ross and consider the most probable reconstruction for the traverse axis to be *pano. The system we propose for POc local-scale reference is represented in ²gure 7. FIGURE 7. THE LOCAL-SCALE SYSTEM OF PROTO-OCEANIC: A SINGLE LAND-SEA AXIS, COMBINED WITH A NEUTRAL TRAVERSE *sake ‘(go) upward; uphill, toward (middle of) island’

*pano

*pano

*sipo ‘(go) downward; downhill toward (deep) sea’

‘(go) away, across, neither up[hill] nor down[hill]’

18

oceanic linguistics, vol. 43, no. 1

As far as local-scale reference is concerned, POc thus behaved exactly like modern Saliba, Ambae, Nemi, Xârâcùù, and Marquesan. In other words, these languages can be said to be conservative in this domain, whereas other languages have gone through later innovations (see section 5, “A functionally based hypothesis for later innovations”). 4.2 PROTO-OCEANIC AT SEA. At sea, when no island was visible or relevant, the speakers of POc could obviously not use the land/sea axis, let alone the traverse axis derived from it. In order to locate themselves in space, they could only refer to natural phenomena. Now, except for Drehu—and possibly Iaai—which seem to have innovated a sun-based axis (Ozanne-Rivierre 1997:90), we are not aware of any Oceanic language in which the rising and setting of the sun is demonstrably the source of the geocentric system of reference. The fact that the cardinal axis of certain languages happens to point toward cardinal east does not necessarily imply that it is ultimately motivated by the sun (Palmer 2002a:117); it can perfectly well be a coincidence due, for example, to the physical orientation of a shoreline. The languages we have examined overwhelmingly suggest the existence of only one cardinal axis in POc, motivated by the direction of the prevailing winds. Just like most modern Oceanic languages, their common ancestor Proto-Oceanic was spoken in the southern hemisphere, probably in the Bismarck archipelago (Ross 1995; Ross, Pawley, and Osmond 1998); in this region, too, the prevailing trade winds blow from southeast, and unless further technical investigation contradicts this hypothesis, we will take it that the compass orientation of the cardinal axis was essentially from northwest to southeast. Furthermore, it is not dif²cult to infer from 3.3 that this axis was lexi²ed as ‘up’–‘down’ in POc, using the same lexemes as for the land/sea axis: *sake ‘in the southeast direction’, *sipo ‘in the northwest direction’. As we saw earlier, the resort to the vertical axis re³ects the same metaphor as English upwind vs. downwind. In an article entitled “Proto-Oceanic terms for meteorological phenomena,” Malcolm Ross (1995) reviews in detail the mechanisms of winds in the Paci²c, and their linguistic counterpart. The PMP terms *timuR ‘east/south-east monsoon’ and *habaRat ‘west/northwest monsoon’, which were used to form the cardinal axis in PMP (Blust 1997; Adelaar 1997), had changed their meaning in POc: no direction was entailed any more in POc *timu(R) ‘wind bringing light rain’; and *apaRat ‘wet season when northwesterlies blow and sea is rough’ has ended up designating a season rather than a wind. As for the winds themselves, Ross (1995:282) reconstructs the following terms for POc: *tokalau(r) ‘northwest storm wind (?)’; *karak(a) ‘(strong?) southeast trade’; *m[u,i]ri ~ *marau ‘southeast trade wind’; *aqura ‘wind, particularly southeast trade’. Later, Ross has this to say about winds and cardinal directions: “Modern uses of wind terms suggest strongly that they also served as directional terms in POc. Modern usage and modern re³exes also indicate that each term referred to a rough quadrant rather than a point. … [T]raditional cardinal directions are likely to be somewhat variable. The term for ‘southeast trade wind’ applied to approximately the southern quadrant, the term for ‘northwest storm wind’ to the northern. What of the eastern and western quadrants? These seem to have been described in POc (and in many non-Oceanic Austronesian languages) as ‘the place of the sun’s rising’ and

the geocentric system of proto-oceanic

19

‘the place of the sun’s setting’. As a result, re³exes of POc *sake ‘rise’ and *sipo ‘set’ often occur as a part of terms for east and west. … [I]t is not clear whether *sake and *sipo alone meant ‘east’ and ‘west’ in POc” (Ross 1995:285–86). In other words, Ross suggests a system like the one in ²gure 8 (we use points for the sake of simplicity, but the author mentions rough quadrants). His proposal must be acknowledged as being the ²rst consistent hypothesis regarding the cardinal system of Proto-Oceanic. In doing so, the author himself is aware that the analogy across language families must be handled carefully, and that POc probably had its own peculiarities: for example, he notes that each POc directional “referred to a rough quadrant rather than a point,” as opposed to the western compass. Nonetheless, the pattern he proposes still betrays some degree of analogy with the absolute systems widespread in Europe and in Asia: ²rstly, because it possesses four balanced terms; secondly, because it is based partly on the path of the sun. This implicit analogy probably explains why Ross feels it necessary to rotate the terms for ‘northwest’ and ‘southeast’ so as to form a north–south axis. The hypothesis we would like to set forth here is somewhat more extreme in suggesting drastic differences between Proto-Oceanic and other language families. If we follow the reasoning begun in section 3, it is probable that the cardinal system of POc consisted of only one axis running from northwest to southeast, and lexi²ed respectively as *sipo ‘down’ vs. *sake ‘up’. This axis was motivated by the prevailing winds, which blow from northwest and—especially—from southeast. In other terms, far from being orthogonal to the wind-based axis as in ²gure 8, the up–down pair of directionals precisely coincided with it. Incidentally, this situation is preserved in Mwotlap, where togle < *tokalau(r) designates the northwest wind, while hôw < *sipo refers to the corresponding northwest direction. Both terms can be combined together, proving they have the same cardinal reference: (1) Ne-le¾ art-wind

ni-tiglô me HÔW lo-TOGLE. aor-appear hither down loc-northwesterly

‘The wind started to blow from down there, from northwest.’ As far as the navigational scale is concerned, Proto-Oceanic thus essentially divided space in two halves, rather than in four quadrants. The system we reconstruct is illustrated in ²gure 9, which can be compared with ²gure 4. A ²nal point of debate would be whether Proto-Oceanic possessed a traverse axis on the navigational scale. As we have seen, certain modern languages have one, others don’t (see 3.3.1). Our idea is the following: if it is true that the cardinal axis was lexi²ed FIGURE 8. THE CARDINAL SYSTEM OF POC ACCORDING TO ROSS (1995) *tokalau(r) ‘NW storm wind’ > north *sipo ‘(sun)set > west

*sake ‘(sun)rise’ > east *karak(a) [?] ‘SE trade wind’ > south

20

oceanic linguistics, vol. 43, no. 1

the same way as the local scale (*sake–*sipo), then this exact parallelism would have made it natural for speakers to also make use of a cross-axis in their navigational subsystem whenever they would need it, in order to designate those directions that were ‘neither upwind nor downwind’. In that event, the relevant directional verb would have been the same as on the local scale (3.4.2), *pano. 5. A FUNCTIONALLY BASED HYPOTHESIS FOR LATER INNOVATIONS. The geocentric system we have reconstructed for Proto-Oceanic consists of two separate contexts. Both of them employ the three directionals de²ned on the vertical axis (*sake ‘up’, *sipo ‘down’, *pano ‘across; neither up nor down’), but rede²ne them so as to encode vectors on the horizontal plane: • in the “local context” of a village, a valley, or a small island, the vertical axis is mapped onto the topography: *sake ‘uphill, inland’; *sipo ‘downhill, seaward’; *pano ‘across, parallel to the shore’ (²gure 7); • in the context of seafaring, or inter-island communication, the vertical axis coincides with the direction of the main winds: *sake ‘upwind, southeast’; *sipo ‘downwind, northwest’; *pano ‘across, either northeast or southwest’ (²gure 9). 5.1 WHEN THE SCALES INTERFERE WITH EACH OTHER. Obviously, in the POc system as we reconstruct it, the same radicals represented different directions, which sometimes happened to be identical (e.g., when the hinterland was located southeast: *sake), but could perfectly clash with each other (e.g., when going seaward *sipo was going southeast *sake). This situation is not unknown in some modern languages that have retained the system of Proto-Oceanic. See what Anna Margetts says about Saliba: “The coordinates of the two scales can overlap to any degree and assign the directional terms to the same as well as to different or even opposite directions, depending on the orientation of the shore line. This is to say that there is no necessary or even typical alignment between hill-ward and east, and between sea-ward and west. This can lead to confusion and sometimes require negotiating on which scale a term is used” (Margetts 1999:123). FIGURE 9. THE NAVIGATIONAL-SCALE SYSTEM OF PROTO-OCEANIC: A SINGLE (NW-SE) CARDINAL AXIS, AND PERHAPS A TRAVERSE *sipo ‘(go) downward; downwind, toward northwest’

*pano

*pano ‘(go) away, across, neither up[wind] nor down[wind]

*sake ‘(go) upward; upwind, toward southeast’

the geocentric system of proto-oceanic

21

In theory, the two subsystems of orientation are used in distinct contexts, and there should be no confusion between directions on the two scales. However, it is not dif²cult to imagine ambiguous situations, where both the navigational and the land system would become equally relevant. The subsystems could mainly interfere in two ways: (1) the land coordinates become salient while at sea: whenever a ship would come closer to a speci²c island, the speakers tended to resort not only to the navigational system, but also to the land/sea axis, as if they were already thinking in the context of land; (2) the sea coordinates become salient while on land: whenever the speakers on land would mention locations on other islands, or remote places within their own (large?) island, they tended to resort not only to the local-scale system, but also to the navigational one, as if they were thinking in the context of seafaring. Despite their difference, these two pragmatic situations had the same effect upon space reference: the overlapping of the local-scale and the navigational-scale subsystems, in a way that regularly “require[d] negotiating on which scale a term [was] used” (Margetts 1999:123). For example, suppose speakers A and B are paddling toward an island: if A employs the directional term *sake (e.g., ‘You should paddle a bit more upward’), it will be ambiguous whether the system of reference is the navigational scale—hence *sake ‘Paddle a bit more upwind, toward southeast’—or the land/sea axis—hence *sake ‘Paddle a bit more uphill, closer to the shore’. If B doesn’t get the point, A will have to disambiguate his sentence, by adding more information (e.g., deictic: ‘upward this way’; or lexical: ‘upward toward land’; and so on). If such interfering contexts are frequent in daily life, the ambiguity of directional terms may bring about unsuccessful or laborious speech interactions, which is always a strong pressure toward language change. Of course, speakers can manage to “get by” in the same way across generations, as is precisely witnessed in modern Saliba. If they did, they preserved the original version of the Proto-Oceanic geocentric system—that is, two distinct subsystems, with a gray zone at their intersection (see ²gure 10). Although this system can perfectly be perpetuated across centuries, several of its features still may cause ambiguity and indecision. First, in the gray zone between scales, the relationship between both axes is unsteady. Second, the two axes are lexi²ed in the same way, which results in a disturbing homophony. Third, the traverse axis on both scales has the disadvantage of being undifferentiated on its sides, and this again typically brings about situations of misunderstanding.

N

FIGURE 10. STAGE 1 OF OCEANIC EVOLUTION (PROTO-OCEANIC): TWO OVERLAPPING SCALES, EACH HAVING ONE UP–DOWN AXIS PLUS A TRAVERSE UP [-hill] overlap and ambiguities UP [-wind] local scale

navigational scale

22

oceanic linguistics, vol. 43, no. 1

All these functional shortcomings began to be progressively compensated for by innovating strategies across the daughter languages of Proto-Oceanic, whether in earlier or later stages in the family’s history. The remainder of this paper consists in reconstructing the principal steps of this evolution, following their most probable chronology. In doing so, we will make sure that the geocentric system reconstructed at each stage is still witnessed in one modern language at least, and also that it constitutes a plausible historical answer to the functional constraints that weigh on this type of space reference. 5.2 THE EMERGENCE OF A HYBRID SUBSYSTEM. A ²rst step in the alteration of the directional system was probably the emergence of an intermediate scale, resulting from the hybridization of the local and the navigational scales. Certain modern languages—for example, Northeast Ambae—are very close to the system of stage i above, except for one property: although their local- and navigational-scale subsytems are identical to ²gure 10, they regularly allow the two up– down axes (land/sea axis + wind-based cardinal axis) to be employed simultaneously on land. This new combination takes place precisely in the contexts where the stage i system was irresolute, in that gray zone between land and sea. This new subsystem, which can be called intermediate scale, corresponds to those situations where the places referred to are still located on land—hence the use of the land/sea axis—but are so remote that the local scale must give way to a novel subsystem that borrows the cardinal axis from the navigational scale. Therefore, the ²rst important innovation that has to be reconstructed for Oceanic languages is the creation of an intermediate scale employing simultaneously the two up–down axes on dry land (Ozanne-Rivierre 1997:88). This scale typically corresponds to coastal contexts, while the local scale is associated with inland areas, and the navigational scale with deep sea. This stage ii is represented in ²gure 11. Of course, this hybrid subsystem did not eliminate the ambiguities we mentioned earlier, as it still made use of two up–down axes. But in comparison with the somewhat wavering system of stage i, the creation of an intermediate scale had the positive effect of stabilizing the relationship between the two up–down axes: by de²ning a balanced set of four equal quadrants, this new system probably helped improve the pragmatic and cognitive tasks of information processing in the relevant contexts. FIGURE 11. STAGE II OF OCEANIC EVOLUTION: EMERGENCE OF AN INTERMEDIATE SCALE COMBINING TWO UP–DOWN AXES up [-hill]

up [-hill] up [-wind] up [-wind]

local scale

intermediate scale

navigational scale

the geocentric system of proto-oceanic

23

This combination of the land/sea and the cardinal axes presents a corollary that remarkably distinguishes stage ii from stage i. Because the two axes could only constitute a consistent system if they crossed each other at right angles, the cardinal axis often had to be pivoted in order to follow closely the shape of the coast. This is why the direction coded up(-wind) in the intermediate scale sometimes turns out to be quite different from the one at sea, as we saw in 3.4.1. Finally, it is possible that the development of stage ii was favored by certain geographic situations, such as a long, outspread island characterized by a high number of small communities. For example, it is the system still attested in most modern languages of the New Caledonian Mainland—Xârâcùù (Moyse-Faurie 1995), Cèmuhî (Rivierre 1980:123; Ozanne-Rivierre 1997:87), Nemi (Ozanne-Rivierre 1999), Nyelâyu (Ozanne-Rivierre 1998), Nêlêmwa (Bril, forthcoming)—probably because the speakers there are constantly referring not only to their own village or valley (local scale), but also to the neighboring communities scattered along the coast of the same island (intermediate scale). Further research is needed to determine what precise conditions could—and historically did—motivate this sort of innovation; if some determinism can be hypothesized, then this could provide the historical linguist with an important clue, say, in order to locate the homeland of protolanguages. 5.3 RELEXIFICATION OF THE LAND/SEA AXIS. Despite its advantages, this ²rst innovation did not solve the problem of the homophony between directionals (5.1). The next stage in the evolution of geocentric reference precisely consisted in the lexical differentiation between the two axes of the intermediate scale. Now, if we refer back to table 1, we observe that the axis that has always been preserved as up–down is the cardinal axis. When a relexi²cation has occurred, it always concerns the land/sea axis. It seems possible to propose a hypothesis to account for this strong tendency. In a system of stage ii, two speakers would “negotiate” the meaning of a word like up by providing more lexical or grammatical information: up there ~ up toward the shore ~ up toward the hill, and so forth. It was easy to increase the precision of a sentence when the up–down axis corresponded to the land/sea axis, because this context is associated with several elements that are cognitively salient and highly lexicalized, like the shore, the bush, the island, the mountain, the sea, and so on; consequently, there were plenty of alternative ways to lexify this land/sea axis, as is witnessed by modern languages. On the contrary, users of a stage ii language would certainly have been embarrassed if they were to ²nd another expression for the cardinal axis: the prevailing winds, although being certainly the source of the POc system, are cognitively not as salient as a visible island can be; and it is not even sure that all speakers were equally able to motivate this up-down axis in relation with the winds: nowadays, too, informants can explain the land/sea axis much more easily than the cardinal axis. This is probably why the axis that always preserved the terms up and down is paradoxically the one in which this vertical metaphor is less obvious, that is, the cardinal one. A good example of such a system is found in Makian Taba. Bowden (1997) is indeed one of the only authors who explicitly distinguishes not two, but three scales for the observation of geocentric space reference: “small-scale orientation” on one end,

24

oceanic linguistics, vol. 43, no. 1

“worldwide orientation” on the other, and “intermediate-scale orientation” in between; according to us, these three subsystems are well illustrated by ²gure 12. Yet to be precise, two remarks must be made concerning this language. First, the up–down axis used on the island of Makian has now lost its connection with the cardinal axis used at sea, as it has become a circular system, with up (originally ‘upwind’) eventually changing into counter-clockwise (see 3.4.3). Secondly, Taba cannot be said to have historically evolved from POc, because, of course, it is not an Oceanic language (see ²gure 3). But it remains possible to suggest that the common ancestor of POc and of SHWNG (i.e., Eastern Malayo-Polynesian) possessed a stage i type of system, which POc retained for some time, whereas Taba progressively evolved toward stage iii— arguably via stage ii—to say nothing of later innovations such as the circular axis. In other words, even if Taba cannot be listed among the descendants of POc, it does provide a good illustration of the kind of innovations that are logically possible after stages i and ii, and that have evidently occurred elsewhere in the Paci²c. Such issues remain open to discussion and further investigation. As far as Oceanic languages are concerned, stage iii is still represented by certain Polynesian languages such as modern Marquesan. And even if this is not made clear in table 1, Iaai also seems to be concerned by this evolution. Indeed, although this language still marginally employs the up–down contrast for both axes (see the appendix), it has been increasingly dedicating speci²c words to the land/sea axis, namely hoot ‘on dry land’ vs. hnyi-köiö ‘at sea’ (Ozanne-Rivierre 1997:90; forthcoming): according to our interpretation, Iaai is thus presently in the process of shifting from stage ii to stage iii. Generally speaking, the lexical implementation of the land/sea axis is diverse among Oceanic languages: some employ former locative nouns (e.g., bush vs. sea), others resort to an in vs. out contrast, and so on (3.2). This tends to strongly con²rm that stage iii corresponds to later and/or parallel innovations across the Paci²c. 5.4 THE HYBRID SUBSYSTEM GENERALIZED ON LAND. The next step in the evolution of geocentric reference was demonstrably the disappearance of the traverse axis on the local scale, and its replacement by the cardinal axis everywhere on land. In a stage iii type of system, the inhabitants of an island refer to directions parallel to the shore by employing two distinct devices: on the one hand, they use an undif-

the geocentric system of proto-oceanic

25

ferentiated traverse as long as they remain in their familiar village or area (local scale); but on the other hand, they are accustomed to locating neighboring spots along the same coast, by means of a cardinal axis oriented up–down (intermediate scale). By allowing more precision, the latter increases the probability for successful speech acts. It is therefore not dif²cult to imagine how strongly Oceanic languages have tended to generalize the two-axis subsystem of stage iii (intermediate scale) on all areas where it was possible. Our evidence shows that many languages have gone through this process of merging the local with the intermediate scale, thus de²ning a single subsystem on land (we can now speak of a land scale). In doing so, they in fact did no more than extrapolate the cardinal axis—already used for remote reference on land—to their very close setting, including for short distances of yards or inches. This innovation had the direct consequence of rendering the traverse axis redundant and useless. Indeed, in all languages corresponding to stage iv, the term for ‘across, neither inland nor seaward’ was completely swept out of the system used on land.7 This spectacular phenomenon is obvious from the two far-right columns of table 1: whenever the cardinal axis is allowed on the local scale, the undifferentiated traverse is absent from the language (see 3.4). Moreover, and somewhat paradoxically, this sudden disappearance of the traverse axis on land was often followed by its fading at sea. Figure 13 represents this new stage of Oceanic evolution. In our Oceanic corpus, the geocentric system of stage iv is witnessed by Yabêm, Kokota, Longgu, Kwaio, Mwotlap, and Anejoü: these are exactly the languages we had listed in 3.4.1. Such a coincidence must not be taken for granted, as it provides one important piece of information: as far as we know, no Oceanic language is attested in which the local scale would be a combination of two up–down axes. In other terms, whenever the land/sea axis is lexi²ed up–down, it combines with a traverse; whenever the cardinal axis is compatible with the local scale, it combines with a land/sea axis that is not lexi²ed up– down. According to us, this sort of unpredictable correlation can only be formulated in FIGURE 13. STAGE IV OF OCEANIC EVOLUTION: MERGER OF LOCAL AND INTERMEDIATE SCALES INTO A SINGLE LAND SCALE (inland) up [-wind]

FIGURE 12. STAGE III OF OCEANIC EVOLUTION: RELEXIFICATION OF THE LAND-SEA AXIS

up [-wind] (seaward)

(inland)

(inland) up [-wind]

land scale

navigational scale

up [-wind] (seaward) local scale

(seaward) intermediate scale

navigational scale

7. In Mwotlap the directional van (< *pano) has survived, but has changed its meaning into that of a personal directional ‘toward a speci²c participant (excluding speaker)’ (François 2003:412). It has more or less replaced the former directional *atu, which is still attested in the neighboring languages of Vanua-Lava and Gaua.

26

oceanic linguistics, vol. 43, no. 1

terms of relative chronology of innovations: in this case, the relexi²cation of the land/ sea axis (stage ii → stage iii) must historically have occurred prior to the merger of local and intermediate scales (stage iii → stage iv). This type of empirical evidence tends to con²rm the chronological scenario we reconstruct for the Oceanic family. 5.5 SYNTHESIS: INNOVATING SPACE REFERENCE. Of course, further innovations have been attested locally: Manam and Boumaa Fijian have developed a circular system (3.4.3); Drehu has created a second cardinal axis (Ozanne-Rivierre 1997:90); Tokelauan has adapted the land/sea axis to the unusual shape of atolls (Palmer 2002a:140); and so on. However, we shall end here our historical reconstructions, as they already make it possible to account for the essential part of geocentric systems attested throughout Oceania. We have thus tentatively reconstructed four distinct stages in the evolution of the geocentric system of Proto-Oceanic; they are summarized in table 2. It is assumed that POc itself corresponded to stage i, while all other stages should correspond to later innovations of Oceanic languages. For each stage, the right column of table 2 cites at least one modern language as a contemporary witness. Simple though it may be, this table covers most of the diversity attested throughout Oceania. For example, despite being impressive at ²rst sight, the differences between the modern systems of Saliba and Longgu are easily understood when one realizes that Saliba has preserved the stage i system of POc, whereas Longgu has apparently innovated as far as stage iv. Ideally, the set of innovations de²ned here could also be used as a diagnosis for subgrouping within the Oceanic family, in a way very similar to phonetic innovations. For example, if all languages in a given subgroup belong to stage iii or iv, it is likely that their protolanguage belonged itself to stage iii, and so on. Needless to say, such ²ne-grained historical hypotheses would need in²nitely more data in each subgroup than are currently available. Also, it may be necessary to underline the fact that, much more than phonological innovations, a linguistic change on such a topic as geocentric space reference is typically the sort of innovation that may be induced by situations of cultural contact and areal convergence rather than strict genetic inheritance. Prudence would therefore certainly be required when manipulating these reconstructions for subgrouping purposes. TABLE 2. THE FOUR DIACHRONIC STAGES OF GEOCENTRIC REFERENCE IN OCEANIA local scale

intermediate scale

navigational scale

(valley, village)

(land-sea interface)

(sea + inter-island)

stage i

UP[hill]

+ traverse

stage ii

UP[hill]

+ traverse

stage iii

inland + traverse

stage iv

(unsystematic) UP[hill]

+ UP[wind]

inland + UP[wind]

inland + UP[wind]

modern witnesses

UP[wind]

(+ traverse)

Saliba

UP[wind]

(+ traverse)

Ambae

UP[wind]

(+ traverse)

Marquesan

UP[wind]

(+ traverse)

Longgu

the geocentric system of proto-oceanic

27

6. CONCLUSION. The reconstruction we have proposed is still tentative, and has no other aim than to foster discussion. On the basis of the empirical observation available to us, we have hypothesized a plausible geocentric system for Proto-Oceanic, as well as a probable chronological scenario for its evolution across its daughter languages. Being empirical, our hypotheses still have to be challenged and amended by further research. So far, only a small number of modern Oceanic languages have bene²ted from a detailed description of their geocentric system, and it is to be expected that the future empirical observations will reserve some surprises. New data can help improve either our reconstruction of the very POc system, or at least our claims about its later developments. For example, suppose a language is found in which the smaller scale combines two up–down axes, then the relative chronology between stages ii, iii, and iv will have to be amended (see 5.4). Conversely, if the remaining languages of Oceania con²rm our ²rst impressions, then it is hoped that some historical reconstruction may be achieved, similar to the one we have been suggesting in this paper.

APPENDIX This appendix aims at discussing brie³y the geocentric directional systems of those modern Austronesian languages that we included in our comparative sample (section 3)—at least when our own interpretation differs from our bibliographical source. When they are not indicated in the text, our references are: Adelaar (1997) for Balinese; Bowden (1997) for Taba; Margetts (1999:123) for Saliba; Streicher (1982) for Yabêm; Palmer (2002a,b) for Kokota; Hill (1997) for Longgu; François (2003) for Mwotlap; Hyslop (2001) for Northeast Ambae; Lynch (2000) for Anejoü; Ozanne-Rivierre (1997; 1999) for Nemi; Ozanne-Rivierre (1997; forthcoming) for Iaai; Moyse-Faurie (1995), MoyseFaurie and Néchérö-Jorédié (1986) for Xârâcùù; Rehg (1981:288) for Pohnpeian; Churchward (1951:58), and Mosel and Hovdhaugen (1992:95) for Samoan; Lavondès (1983) for Marquesan. Taba. Bowden (1997) makes a distinction between three scales of reference. In table 1, we only consider his “small-scale orientation” (a land/sea axis + a traverse) and his “worldwide orientation” (a cardinal axis). We do not include the “intermediate-scale orientation” of Makian Taba—a circular system—because it probably results from a local innovation: see the discussions in 3.4.3 and 5.3. Yabêm. Although Yabêm is classic in using a cardinal axis lexi²ed up–down, it is more remarkable in orienting it in the opposite direction when compared to other Oceanic languages: up apparently points west instead of expected (south)east. A ²rst explanation would tentatively suggest that the strongest winds in this area (southeastern tip of the Huon peninsula) are not the southeast trade winds, but the northwest monsoons (see Ross 1995:269). Alternatively, it may be necessary to take into account the very shape of the Huon peninsula: indeed, to follow the shore “upward” from Yabêm to Lae indeed means to go west (Streicher 1982); but this portion of land is just a short break along a coastline whose main orientation is southeast (from Madang to Yabêm, from Lae to Morobe). More needs to be known about space reference in this area. But whatever the answer to these questions, this “up = west” axis in Yabêm is strong evidence against the path-of-the-sun hypothesis: winds can be found to change directions much more easily than the sun. Longgu. Hill (1997) glosses the pair of directionals ala‘a–toli as ‘east’–‘west’, which is consistent with the interpretation she proposes in connection with the sun. However, her maps show an axis running from southeast to northwest—and even south to north in some places.

28

oceanic linguistics, vol. 43, no. 1

As for the etymology, we propose for ala‘a–toli as ‘up’–‘down’; it is supported by neighboring Kwaio ‘a-la‘a ‘up, upward; south-east’ and ‘ai-sifo ~ ‘ai-tori ‘down, downward; northwest’, from tori ‘fall’ (Keesing 1997:135). This is why we would tentatively question the pathof-the-sun hypothesis (3.3.3), even when it is proposed by native speakers: there is every likelihood that the up–down system of Longgu is similar to that of other Oceanic languages. Kokota. The reasoning for Kokota is detailed in 3.3.2. Iaai. To be precise, modern Iaai uses two forms for the vertical axis (dhöö ‘up, above’ / jii ‘down, below’), which are distinct from the directionals involved in geocentric reference. In order to account for the polysemy of iö (‘inland, on high ground; east; up’) and of ü (‘toward the sea; west; down’), Ozanne-Rivierre (forthcoming) tentatively resorts to the particular topography of the island of Uvea, which “slopes from east to west”: according to her, the term ‘east’ would have extended its meaning to ‘inland’, and then to ‘up’. But, one could object, the same polysemies are attested in other languages (e.g., Nemi, Ambae), although their landscapes are not geographically oriented like Uvea. We would propose another interpretation. The original pair of morphemes for the vertical axis was iö ‘up’ – ü ‘down’, which inherited the polysemy of ‘up’ and ‘down’ in POc (see section 4). More recently, Iaai began to develop the use of two morphemes dhöö–jii (perhaps two adverbs ‘above’–‘below’?) to code for the strictly vertical meanings ‘up’–‘down’, thus competing with the old forms iö–ü; the latter, however, have survived in non-vertical usages of the ‘up’–‘down’ contrast (land/sea axis; cardinal axis), and the competition is still going on today. As far as the motivation of the cardinal axis is concerned (wind vs. sun), Ozanne-Rivierre (forthcoming) claims that iö and ü refer to a sun-based east–west axis, by citing texts where iö ‘east’ is associated with the sun’s rising, and ü ‘west’ with its setting. However, even if the system has been recently reinterpreted with reference to the sun, it remains possible that these two directions originated in a distinct landmark (e.g., a wind) in a way that happened to coincide with an east–west axis (Palmer 2002a:117). And, in fact, the colexi²cation of ‘east’– ‘west’ with ‘up’–‘down’ suggests that Iaai ultimately behaves just like other languages conservative of the POc system, and that the wind hypothesis may be the right one (3.3.3). Pohnpeian. Rehg (1981: 288) cites two forms -di ‘downward; leeward’ and -da(k) ‘upward; windward’, putting them in contrast with a land/sea axis. However, we have no indication on the absolute orientation these two directionals may have.

REFERENCES Adelaar, Sander. 1997. An exploration of directional systems in west Indonesia and Madagascar. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 53–81. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Bennardo, Giovanni, ed. 2002. Representing space in Oceania: Culture in language and mind. No. 523. Canberra: Paci²c Linguistics. Blust, Robert. 1997. Semantic change and the conceptualization of spatial relationships in Austronesian languages. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 39–51. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Bowden, John. 1992. Behind the preposition: Grammaticalisation of locatives in Oceanic languages. Series B-107. Canberra: Paci²c Linguistics. ———. 1997. The meaning of directionals in Taba. In Referring to space. Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 251–68. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Bril, Isabelle. Forthcoming. Deixis in Nêlêmwa. In Deixis and demonstratives in Oceanic Languages, ed. by Gunter Senft. Canberra: Paci²c Linguistics.

the geocentric system of proto-oceanic

29

Brown, Penelope, and Stephen Levinson. 1992. ‘Left’ and ‘right’ in Tenejapa: Investigating a linguistic and conceptual gap. Zeitschrift für Phonetik, Sprachwissenschaft und Kommunikationsforschung 45:590–611. ———. 1993. ‘Uphill’ and ‘downhill’ in Tzeltal. Journal of Linguistic Anthropology 3:46–74. Buck, Carl D. 1949. A dictionary of selected synonyms in the principal Indo-European languages. Chicago: University of Chicago Press. Bugenhagen, Robert. 1995. A grammar of Mangap-Mbula, an Austronesian language of Papua New Guinea. Series C-101. Canberra: Paci²c Linguistics. Churchward, Spencer. 1951. Samoan grammar. 2d ed. Melbourne: Spectator Publishing. Codrington, Robert Henry. 1885. The Melanesian languages. Oxford: Clarendon Press. de León, Lourdes. 1994. Explorations in the acquisition of geocentric location by Tzotzil children. Linguistics 32:857–84. Dixon, Robert M. W. 1988. A grammar of Boumaa Fijian. Chicago: University of Chicago Press. François, Alexandre. 2003. Of men, hills, and winds: Space directionals in Mwotlap. Oceanic Linguistics 42:407–37. Haviland, John. 1993. Anchoring, iconicity and orientation in Guugu Yimithirr pointing gestures. Journal of Linguistic Anthropology 3(1):3–45. Hill, Deborah. 1997. Finding your way in Longgu: Geographical reference in a Solomon Islands language. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 101–26. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Hyslop, Catriona. 2001. The Lolovoli dialect of the North-East Ambae language, Vanuatu. No. 515. Canberra: Paci²c Linguistics. ———. 2002. Hiding behind trees on Ambae: Spatial reference in an Oceanic language of Vanuatu. In Representing space in Oceania: Culture in language and mind, ed. by Giovanni Bennardo, 47–76. No. 523. Canberra: Paci²c Linguistics. Irwin, Geoffrey. 1992. The prehistoric exploration and colonisation of the Paci²c. Cambridge: Cambridge University Press. Keesing, Roger. 1997. Constructing space in Kwaio (Solomon Islands). In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 127–41. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. Lavondès, Henri. 1983. Le vocabulaire marquisien de l’orientation dans l’espace. L’Ethnographie 79(1):35–42. Levinson, Stephen. 1992. Language and cognition: The cognitive consequences of spatial description in Guugu Yimithirr. Working Paper no. 13. Nijmegen: Cognitive Anthropology Research Group, Max Planck Institute for Psycholinguistics. ———. 1996a. Frames of reference and Molyneux’s question: Crosslinguistic evidence. In Language and space, ed. by Paul Bloom, Mary Peterson, Lynn Nadel, and Merrill Garrett, 109–70. Cambridge, Mass.: The MIT Press. ———. 1996b. Language and space. Annual Review of Anthropology 25:353–82. ———. 1996c. The body in space: Cultural differences in the use of body-schema for spatial thinking and gesture. Working Paper no. 39. Nijmegen: Cognitive Anthropology Research Group, Max-Planck Institute for Psycholinguistics. Levinson, Stephen, and Penelope Brown. 1993. ‘Uphill’ and ‘downhill’ in Tzeltal. Journal of Linguistic Anthropology 3:46–74. Lewis, David. 1972. We, the navigators. Honolulu: University of Hawai‘i Press. Lichtenberk, Frantisek. 1983. A grammar of Manam. Oceanic Linguistics Special Publications No. 18. Honolulu: University of Hawai‘i Press. Lynch, John. 2000. A grammar of Anejoü. No. 507. Canberra: Paci²c Linguistics.

30

oceanic linguistics, vol. 43, no. 1

Margetts, Anna. 1999. Valence and transitivity in Saliba. MPI Series in Psycholinguistics. Nijmegen: Max Planck Institute for Psycholinguistics. Mosel, Ulrike. 1982. Local deixis in Tolai. In Here and there: Cross-linguistic studies on deixis and demonstration, ed. by Jürgen Weissenborn and Wolfgang Klein, 111– 32. Pragmatics and Beyond. Amsterdam: John Benjamins. Mosel, Ulrike, and Even Hovdhaugen. 1992. Samoan reference grammar. Oslo: Scandinavian University Press. Moyse-Faurie, Claire. 1983. Le Drehu, langue de Lifou (îles Loyauté), vol.3. Langues et cultures du Paci²que. Paris: Société d’Etudes Linguistiques et Anthropologiques de France. ———. 1995. Le Xârâcùù, langue de Thio-Canala (Nouvelle-Calédonie). Langues et cultures du Paci²que, 10. Paris: Peeters. Moyse-Faurie, Claire, and Marie-Adèle Néchérö-Jorédié. 1986. Dictionnaire Xârâcùù– Français (Nouvelle-Calédonie). Nouméa: Edipop. Osmond, Meredith. 2000. Star, wind and wave: Searching for early Oceanic navigation terms. In SICOL: Proceedings of the Second International Conference on Oceanic Linguistics, vol.2: Historical and descriptive studies, ed. by Bill Palmer and Paul Geraghty, 3–35. Canberra: Paci²c Linguistics. Ozanne-Rivierre, Françoise. 1984. Dictionnaire Iaai-Français (Ouvéa, Nouvelle-Calédonie). Langues et cultures du Paci²que, 6. Paris: Société d’Etudes Linguistiques et Anthropologiques de France. ———. 1997. Spatial reference in New Caledonian languages. In Referring to space. Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 84–100. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. ———. 1998. Le Nyelâyu de Balade (Nouvelle-Calédonie). Langues et cultures du Paci²que, 12. Paris: Peeters. ———. 1999. Spatial orientation in some Austronesian languages. In Language diversity and cognitive representations, ed. by Catherine Fuchs and Stéphane Robert, 73–84. Amsterdam: John Benjamins. ———. Forthcoming. Spatial deixis in Iaai (Loyalty Islands). In Deixis and demonstratives in Oceanic Languages, ed. by Gunter Senft. Canberra: Paci²c Linguistics. Palmer, Bill. 2002a. Absolute spatial reference and the grammaticalisation of perceptually salient phenomena. In Representing space in Oceania: Culture in language and mind, ed. by Giovanni Bennardo, 107–57. No. 523. Canberra: Paci²c Linguistics. ———. 2002b. Kokota. In The Oceanic languages, ed. by John Lynch, Malcolm Ross, and Terry Crowley, 498–524. London: Curzon Press. Rehg, Kenneth. 1981. Ponapean reference grammar. Honolulu: University of Hawai‘i Press. Rivierre, Jean-Claude. 1980. La langue de Touho. Phonologie et grammmaire du cèmuhî (Nouvelle-Calédonie). lacito-documents. Paris: selaf. Ross, Malcolm. 1995. Proto-Oceanic terms for meteorological phenomena. Oceanic Linguistics, 34:261–304. Honolulu: University of Hawai‘i Press. ———. 2004. The grammaticisation of directional verbs in Oceanic languages. In Complex predicates in Oceanic languages: Studies in the dynamics of binding and boundness, ed. by Isabelle Bril and Françoise Ozanne-Rivierre, 297–329. Empirical Approaches to Language Typology. Berlin: Mouton de Gruyter. Ross, Malcolm, Andrew Pawley, and Meredith Osmond, eds. 1998. The lexicon of Proto-Oceanic: Material culture. Series C-152. Canberra: Paci²c Linguistics. Senft, Gunter. 1997. Introduction. In Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 1–38. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press.

the geocentric system of proto-oceanic

31

———, ed. 1997. Referring to space: Studies in Austronesian and Papuan languages, ed. by Gunter Senft, 1–38. Oxford Studies in Anthropological Linguistics. Oxford: Oxford University Press. ———, ed. Forthcoming. Deixis and demonstratives in Oceanic Languages. Paci²c Linguistics. Canberra: Australian National University. Streicher, J. F. 1982. Jabêm–English dictionary. Paci²c Linguistics, C-68. Canberra: Australian National University. Svorou, Soteria. 1994. The Grammar of Space. Typological Studies in Language. Amsterdam: Benjamins. Wilkins, David, and Deborah Hill. 1995. When go means come. Cognitive Linguistics 6, 209–59.

LACITO-CNRS 7, rue Guy Môquet 94801 Villejuif FRANCE [email protected]

Language Profile A typological overview of Mwotlap, an Oceanic language of Vanuatu ALEXANDRE FRANÇOIS

Abstract The typologist reader is presented here with an overview of the most interesting characteristics of Mwotlap, an Oceanic language of Vanuatu. After a short presentation of its phonology, its main morphosyntactic categories are described and explored from a functional angle. The construal of noun phrases reveals a cognitive asymmetry between human individuals and other referents. Nouns, just like verbs or adjectives, are predicative, and are even sensitive to tenseaspect-mood markers and actionality properties. The argument structure of a verb can regularly be affected by its modifiers. Finally, deictics can be shown to play a major role in the structuring of discourse and complex sentences. Whenever relevant, the grammar of Mwotlap is briefly compared to other languages, and assessed in the light of existing typological generalisations. Keywords: actionality, animacy, aspect, clause combining, deixis, Mwotlap, negation, number, incorporation, Oceanic, possession, predication, pronoun, referentiality, serial verbs, valency change, vowel harmony 1.

Introduction

Among the hundred or more Oceanic languages spoken today in the Republic of Vanuatu, Mwotlap is still well alive, being spoken by a dynamic population of 2,000 speakers of all ages. Apart from those who live in Vila, where the Bislama pidgin is threatening the vernaculars, the majority of Mwotlap-speaking people reside on their tiny island of Motalava, in the north of the archipelago. Their way of life, which combines subsistence agriculture and fishing, essentially perpetuates the culture of their Austronesian ancestors who first peopled these rainforest islands about 3,200 years ago. The slow introduction of Western education and economy has had limited impact upon daily life thus far;

Linguistic Typology 9 (2005), 115–146

1430–0532/2005/009-0115 c Walter de Gruyter

116

Alexandre François

but the ancient social organisation and political institutions have been largely ruined by the Christian missionaries over the last 150 years, to such an extent that most of the knowledge regarding the traditional society now only survives in the memory of a few. This paper aims at providing typologists with a synthetic view of Mwotlap grammar (François 2001b, 2003a). For present purposes, we will confine ourselves to the principal wheels of the system and focus on the characteristics that make this language typologically unusual. Although Mwotlap obviously shares a number of properties with other languages of the Oceanic family (Lynch et al. 2002), we will have to keep such comparisons to a minimum, for this might lead us beyond the scope of this presentation. Likewise, the historical dimension will have to be omitted, so that Mwotlap will only be described synchronically. Whenever useful, references to other relevant publications will be given. After a review of its most salient phonological properties (Section 2), the following sections will describe the main regularities of the morphosyntax, as well as the semantic categories and functional motivations they reveal: in the domain of noun phrases (Section 3), in TAM-marked verb phrases and other forms of predicates (Section 4), in the managing of arguments (Section 5), and in the general organisation of the sentence (Section 6). 2.

Phonology

2.1. Phoneme inventory The inventory of consonants is given in Table 1. The system lacks any flap or trill. As for the labial stop [p], it only exists as an allophone of the phoneme /B/ syllable-finally: e.g., /BaBaB/ ‘say’ is realised as [BaBap], and spelt vavap. /G/ often surfaces as a velar glide [î], that is, an unrounded [w]. The only voiced stops are prenasalised /m b/ and /n d/; this is the form taken by plain voiced stops in loanwords: e.g., [OktOm ba] ‘October’. These prenasalised phonemes lose their oral component syllable-finally:1 e.g., the loanword [m bElEkat] (from English play cards) reduplicates as [m bElEm lEkat]; similarly [n dIjI] ‘wait’ becomes [mEn jI] when prefixed with Perfect ¯/mE-/. ¯ Crosslinguistically, labiovelar obstruents may consist of a combination of velar plosive plus labiovelar glide, as [kw ], [gw ] in Proto-Indo-European; labial plosive plus labiovelar glide, as [bw ], [mw ] in many Oceanic languages; or > > > in many languages of Cenlabiovelar plosive without glide, as [kp], [gb], [Nm] tral Africa. Mwotlap illustrates the maximal combination, with labiovelar plo> > w ]. The now extinct dialect sive plus labiovelar glide, namely [kpw ] and [Nm of Volow even had a more complex phoneme, a prenasalised voiced labiovelar > stop [Nm gbw ]. 1. Mwotlap syllables have the form (C)V(C): see Section 2.2.2.

A typological overview of Mwotlap

117

Table 1. The consonants of Mwotlap

voiceless stops prenasalised voiced stops fricatives nasals lateral glides

labiovelar > kpw >w Nm w

bilabial

alveolar

velar

t

k

mb

nd

B m

s n l j

G N

glottal

h

Vowels form a symmetrical system with seven members: /i I E a O U u/, all short. Mwotlap lacks long vowels or diphthongs, as well as tones. All words, or phrases, are stressed on their final syllable. 2.2. Main phonological rules The phonology of Mwotlap is dominated by various forms of distance assimilation between vowels. 2.2.1. Vowel harmony. The Advanced Tongue Root (atr) feature is involved in the contrast between [+atr] /i/–/u/ on the one hand, and their [−atr] counterpart /I/–/U/ on the other hand. Mwotlap is developing a form of [atr] vowel harmony (François 1999; 2001b: 94, 472), which is unusual in the Oceanic area. Indeed, the morphology of inalienable possession (see Table 3 and Section 3.2.3) involves two stems. Stem 1 combines with 1sg suffix -k, and ends with a > vowel other than /a/, e.g., /kpw IlGE-k/ ‘my father-in-law’, /mOju-k/ ‘my uncle’; ¯ vowel that is stem 2 combines with 3sg suffix ¯-n, and always involves a final >w one step lower than stem 1: thus /kp IlGa -n/ ‘his father-in-law’, /mOjU-n/ ‘his uncle’. Now, the rule for vowel harmony¯applies to those lexemes – in¯ fact no more than ten – whose stem 1 displays two high [+atr] vowels /i/ or /u/ in the last two syllables. In this case, the lowering of the final vowel from [+atr] /i/ or /u/ to [−atr] /I/ or /U/ contaminates the preceding syllable(s). This amounts to a form of leftward [atr] harmonisation, e.g., /inti-k/ ‘my child’ → /IntI-n/ ‘his child’; /ni-nini-k/ ‘my shadow’ → /nI-nInI-n/ ‘his shadow’; /n-ulsi/ ‘top (of)’ → /n-UlsI-n/ ‘its top’. Note that this rule does not operate in the other direction. For example, the [−atr] stem 2 /nU-GUjI -n/ ‘its root’ corresponds to a heterogeneous stem 1 ¯ */nu-Guji/. In other words, [−atr] is the active value /nU-GUji/ ‘root (of)’, not in this pattern of vowel harmony. Mwotlap therefore contradicts the general

118

A typological overview of Mwotlap

Alexandre François

tendency observed in Africa (Casali 2003: 356), that a /i I E a O U u/ system should typically result in [+atr] dominance.

Table 2. The personal pronouns of Mwotlap

2.2.2. Vowel epenthesis and vowel copy Also noteworthy in Mwotlap is the set of rules derived from phonotactic constraints. The only acceptable syllable pattern is (C)V(C). This implies that clusters of two (and no more) consonants are common within the word, but impossible in both word-initial and word-final position. Consequently, a root whose underlying form begins with C1 C2 Vi - must undergo vowel epenthesis whenever C1 coincides with the word boundary: C1 C2 Vi - → C1 Vi C2 Vi - / #__; e.g., #mtij → [mitij] ‘sleep’; #BlaG → [BalaG] ‘run’. But this epenthesis is unnecessary when the C1 C2 Vi root takes a prefix of the form CV, like Perfect /mE-/: mE- + mtij → [mEmtij] ‘slept’; mE- + BlaG → [mEplaG] ‘ran’. A corollary of this mechanism is its demarcative function: it helps locate the word boundary, and therefore provides a test to distinguish between compound words and phrases, as well as between affixes and clitics. For example, the single phonological word [na-pnU] ‘a/the village’ shows the nominal article to be an affix (prefix na-, see Section 3.2.1), whereas the sequence [nE BUnU] ‘of the village’ must be analysed as two distinct phonological words, the preposition /nE/ ‘of’ being a clitic. Besides epenthesis, the morphology of prefixes is characterised by pervasive rules of (i) vowel elision (e.g., /na-/ + /Et/ → [n-Et] ‘person’; /mE-/ + /ak/ ‘do’ → [m-ak] ‘has done’); (ii) vowel copy (e.g., /na-/ + /GOm/ → [nO-GOm] ‘sickness’; /mE-/ + /GOm/ → [mO-GOm] ‘got sick’); and (iii) vowel transfer (/na-/ + /BIhOG/ → [nI-phOG] ‘flesh’; /mE-/ + /liwO/ ‘big’ → [mi-lwO] ‘increased’). These rules, which cannot be detailed here, are best analysed in a multi-linear framework, resorting to such notions as “syllabic template” and “floating vowels” (François 2000a, 2001b: 96–128). In the following sections, Mwotlap forms will be cited employing the orthography in use. The conventions include the following: e = [E]; e¯ = [I]; o = [O]; o¯ = [U]; y = [j]; g = [G]; v = [B]; b = [m b]; d = [n d]; n¯ = [N]; q = [kpw ]; m ¯ = [Nmw ].

1inc 1exc 2 3

The mechanics of reference

In order to provide a predicate with its arguments, a preposition with its complement, or a possessed item with its possessor, one needs to refer to entities. This is done essentially by means of personal markers (Section 3.1) and noun phrases (Section 3.2).

singular

dual

trial

plural

no ∼ nok n¯ek k¯e

d¯o ∼ d¯oy¯o kamy¯o k¯omy¯o k¯oy¯o

e¯ nt¯el ∼ d¯et¯el kamt¯el k¯emt¯el k¯eyt¯el

g¯en kem ∼ kemem kimi k¯ey

of person and number. No gender distinction of any kind is made in the morphology of this language. These fifteen categories are then distributed into several paradigms of markers according to their function. The principal set is that of simple personal pronouns (Table 2), which fill the slots of subject, object, complement of preposition: (1)

No m-et k¯oy¯o; k¯oy¯o m-et no. 1sg pft-see 3du 3du pft-see 1sg ‘I saw them, and they saw me.’

Mwotlap follows a strictly nominative–accusative syntax, with SVO as the basic constituent order. In the absence of case marking, the function of the core arguments is only indicated by their position in the sentence. Special emphatic forms, phonologically heavier (e.g., ino 1sg, in¯ek 2sg, (i)d¯oy¯o 1inc.du), must be used in the positions of topic, predicate, or focus: (2)

ino no ta-dam te, qiyig k¯e. Et-in¯ek neg1 -2sg.emph neg2 1sg.emph 1sg hf1 -follow hf2 3sg (lit.) ‘It’s not you, (it’s) me (who) will go with her.’

There is no reflexive or reciprocal2 pronoun. The ordinary pronouns are used in all cases, with resulting ambiguity: (3)

3.

119

K¯oy¯o mu-wuh mat k¯oy¯o. 3du pft-hit dead 3du (i) ‘Theyi killed themj .’ (different participants) (ii) ‘Theyi killed themselvesi .’ (reflexive) (iii) ‘They killed each other.’ (reciprocal)

Such a sentence can be disambiguated, at least partially, by the reversive modifier lok (‘back’):

3.1. Pronouns and personal markers 3.1.1. The main paradigms. The distinction between inclusive and exclusive 1st person, combined with the use of four numbers (singular, dual, trial, plural), is the reason why Mwotlap possesses as many as fifteen combinations

2. The reciprocal prefix v¯ey- is not syntactically productive, and is only attested in a handful of lexical collocations. The result of this derivation is an intransitive verb: tit ‘knock (s.o.)’ → v¯ey-titit ‘fight (with each other)’.

120

Alexandre François

A typological overview of Mwotlap

Table 3. Possessive suffixes and stem variation

1inc 1exc 2 3

(3 )

singular

dual

trial

plural

iplu-k iplu(-Ø) e¯ pl¯o-n

e¯ pl¯o-d¯o iplu-mamy¯o iplu-m¯oy¯o e¯ pl¯o-y¯o

e¯ pl¯o-nt¯el iplu-mamt¯el iplu-m¯et¯el e¯ pl¯o-yt¯el

e¯ pl¯o-ng¯en iplu-mem iplu-mi e¯ pl¯o-y

K¯oy¯o mu-wuh mat lok k¯oy¯o. 3du pft-hit dead rever 3du (i) ??‘Theyi killed themj back.’ (ii) ‘Theyi killed themselvesi .’ (reflexive) (iii) ‘They killed each other.’ (reciprocal)

Another set of personal markers is the list of fifteen possessive suffixes, which combine with inalienable nouns and possessive classifiers (Section 3.2.3). The noun appears either with its stem 1 or its stem 2 (see Section 2.2.1), following some morphological variation which cannot be detailed here. Table 3 illustrates the inflection of nouns for possession, using the inalienable noun iplu ‘friend, fellow’. A particular pattern involving personal pronouns deserves attention: the “inclusory” constructions,3 which are common in Oceania (Lichtenberk 2000). In one of these structures, a first phrase referring to a single person X (noun, proper name) is followed by a non-singular 3rd person pronoun, to refer to a group of people including X: e.g., Edga k¯oy¯o (lit. Edgar they-two) ‘Edgar and his fellow/his wife/his daughter . . .’; dokta k¯ey (lit. doctor they) ‘the doctor and his team/his friends/his relatives . . .’ (distinct from plural ige dokta ‘the doctors’). Another inclusory structure consists of a dual pronoun to be followed by a phrase referring explicitly to the second member Y of the couple: kamy¯o welan (lit. we-two chief) ‘the chief and I’; see (36). The same applies of dual possessive suffixes: (4)

inti-mamy¯o welan child-1exc.du chief ‘the son I had with the chief’ (lit., the child of us-two chief)

Finally, the combination of these two inclusory constructions has paved the way for the 3rd person dual pronoun k¯oy¯o to grammaticalise as the standard

3. These constructions were described by François (2001b: 384–392; 477–481) under the name “associative non-singular”, suggesting a comparison with a similar pattern known as “associative plural” (Corbett 2000: 101–110, Moravcsik 2003).

121

NP coordinator (X k¯oy¯o Y ‘X and Y’), at least when two human individuals are being associated: (5)

No m-et v¯eglal imam k¯oy¯o tita. 1sg pft-see know father 3du mother ‘I recognised dad and mum.’ (lit., . . . dad they-two mum)

3.1.2. Some restricted paradigms. What is particularly original among Mwotlap pronouns is the existence of three sets of markers, whose functional restrictions explain why they are limited to certain persons. First, commands make use of a special list of imperative pronouns, centred on the addressee: Ø for 2sg, amy¯o for 2du, amt¯el for 2tr, ami for 2pl. Imperative modality is therefore coded on the pronoun rather than on the verb: (6)

a.

b.

K¯omy¯o hohole liwo. 2du aor.speak.dup big ‘You’re speaking loudly.’ (statement) Amy¯o hohole liwo! 2du.imp aor.speak.dup big ‘Speak up!’ (command)

Second, the vocative function involves three pronoun-like forms, which of course are also reserved for the second person: yoh¯e ‘you two’, t¯elh¯e ‘you three’, y¯eh¯e ‘you guys’. There is no specific form for the singular; other address strategies are used instead, such as a proper name (except for in-laws), a kin term, or a noun like bulsal! ‘mate!’: (7)

a.

b.

¯ Et! Bulsal! (Ø) van t¯o excl mate (2sg.imp) aor.go polit ‘Hey, mate! Come here for a second.’ ¯ Et! Yoh¯e! Amy¯o van t¯o excl du.voc 2du.imp aor.go polit ‘Hey, you guys! Come here for a second.’

me! hither me! hither

A Mwotlap speaker will use the honorific dual when addressing, or talking about, an in-law. In this specific case, a sentence like (7b) will refer to a single person – as with the French honorific plural vous. Third, the particle wo, which serves for quoting speech and facial expression, may take an ordinary pronoun as its subject (k¯e wo . . . ‘he said: . . .’). But the language also possesses a small set of quotative pronouns exclusively for this purpose, and reserved for the 3rd person: amtan 3sg, amtay¯o 3du, etc. (8)

“M-akteg?!”. T¯o amtan wo then 3sg.quot quot pft-do.what ‘So he went: ‘What’s going on?!’.’

122

Alexandre François

The stylistically marked pronoun amtan is preferred to k¯e when speakers want to make their speech more expressive or recherché, either in a literary or a jocular context (compare English he said vs. he went). Etymologically, these curious forms probably meant ‘his face [went like this . . .]’ (cf. na-mta-n ‘his eyes’). A rarer variant amtal¯nan also includes the radical of na-l¯na-n ‘his voice’. 3.2. Nouns and noun phrases The canonical order of NP elements is stated and exemplified in (9): (9)

a.

b.

article1 – head noun2 – modifying noun3 – adjective4 – purposive phrase5 – possessor6 – numeral7 – quantifier8 – locative9 – deictic10 – relative clause11 – discourse marker12 na1 -tno2 kikbol3 liwo4 no-ng¯en6 v¯oy¯o7 yow9 n¯ok10 art-place soccer big poss-1inc.pl two out there en12 bkg ‘these two large soccer fields of ours over there seawards’

Notice that Mwotlap constitutes no exception to the typological observations made by Greenberg (1963): the post-nominal position of adjectives, possessors, and other modifiers is consistent with its SVO basic constituent order, as well as with the use of prepositions or clause-initial linkers. The possible functions an NP can fulfil are verbal argument (subject, object: see Section 5), complement of preposition (Section 5.3), possessor phrase, or predicate (Section 4.1.1). This section will focus on the internal structure of the noun phrase, presenting the noun and its article (Section 3.2.1), as well as principles for coding number (Section 3.2.2) and possession (Section 3.2.3). Other elements of the NP, such as deictics or relative clauses, will be discussed later. 3.2.1. Noun classes and the individuation scale. Mwotlap possesses two classes of nouns, which differ in their morphosyntactic behaviour. Class I consists of lexemes that may function directly (that is, with no need of the article na-) as the head of an NP. Semantically speaking, these nouns all share the feature [+human]: e.g., imam ‘dad’, moyu-k ‘my uncle’, t¯eyt¯eyb¯e ‘a/the healer’, welan ‘a/the chief’. These Class I nouns fill the same slot as proper names, as well as – to a lesser extent – personal pronouns. Class II consists of those lexemes that need the article prefix na- (∼ nV-) in order to become the head of an NP. Generally speaking, the members of this class II are all [−human] nouns, whether animals, objects, abstract notions, verbal nouns, and so on: e.g., na-bago ‘shark’, ne-vet ‘stone’, na-pn¯o ‘village’,

A typological overview of Mwotlap

123

no-gom ‘sickness’, ne-welan ‘chiefhood’ (vs. welan ‘chief’). The only exceptions to the [−human] rule are the three Class II nouns n-et ‘person’, na-tman ¯ ‘man’, na-lq¯ov¯en ‘woman’. When deprived of its article na-, a Class II lexeme does not form a valid NP, and can only function as a modifier of another head. Thus in each of the following phrases, the second word acts as a modifier to the preceding noun: e.g., n-¯em ¯ vet ‘a stone house’, n-¯em ¯ gom ‘a sickness house (a hospital)’, b¯ob¯o taman ¯ ‘grandparent male (grandfather)’, na-he et ‘a person’s name’. The unprefixed form of the noun is also required after certain linkers, such as ne ‘of’: welan ne v¯on¯o ‘the chief of the village’. Likewise, a bare Class II noun may modify a verbal head, as in the case of object incorporation (Section 5.2.1): ta¯nta¯n et ‘to person-touch (to massage)’, w¯elw¯el l¯oq¯ov¯en ‘to woman-buy (to marry)’. In practically all these cases, the unprefixed Class II noun appears to point to a quality (e.g., vet ‘stony’, taman ‘male’) rather than designate an autonomous ¯ entity; and it is precisely the function of the article na- to embody this quality into a discrete, specific referent (e.g., ne-vet ‘a/the stone’, na-tman ‘a/the ¯ man’). The formal split between these two noun classes can perhaps be explained in functional terms. The faculty of being compatible with both a referential and a non-referential interpretation is typically a characteristic of [−human] nouns, as well as of the three [+human] nouns that are statistically most likely to be used as a generic modifier (‘person’, ‘man’, ‘woman’). All these Class II lexemes are thus potentially ambiguous on the scale of specificity, and this makes the formal contrast /article + N/ vs. /bare N/ functionally meaningful for them. Conversely, the referentiality criterion appears to be less relevant for the nouns of Class I, because designating a person typically implies a high degree of individuation. 3.2.2. Coding for number. The semantic feature of humanhood appears to be the key to understanding several formal categories throughout the grammar of Mwotlap. Indeed, besides accounting for the division of nouns into two lexical classes, the same property is also central to the mechanics of number marking. Briefly, number distinctions are formally coded with human referents, but are neutralised when the referent is non-human (François 2001b: 360–370). 3.2.2.1. Collectives and number articles. We already mentioned the four number categories of Mwotlap in our discussion of pronouns; indeed, person marking is typically a domain where a language should be expected to make number distinctions. As far as NPs are concerned, non-singular number is coded by a triplet of “collective” morphemes. When used on their own, these pronoun-like collectives refer to a group of people, with no other qualification than the feature [+human]: yoge ‘(the) two

124

Alexandre François

people’, t¯elge ‘(the) three people’, ige ‘(the) people’. Unlike standard personal pronouns, these collectives typically designate a new referent (indefinite):4 (10)

a.

b.

Nitog ak magays¯en k¯ey! proh do sad 3pl ‘Stop annoying them!’ (personal pronoun) Nitog ak magays¯en ige! proh do sad coll.pl ‘Stop annoying people!’ (collective)

Most of the time, however, these collectives are followed by some kind of modifier, just like any NP head would be (see 9). This can be an adjective ige qagqag ‘(the) white people’; a locative phrase ige ta-Franis ‘the French’; a purposive phrase ige bi-kikbol (lit., people for soccer) ‘soccer players’; a possessive classifier ige mino (lit., people my) ‘my people, my family’; or a deictic yoge g¯oh ‘these two people’. For each of these phrases, the syntactic head is clearly the collective. Of course, nothing prevents this modifier from being a noun, as long as it is [+human]: t¯elge taman (lit. three-people male) ‘(the) three men’, yoge ¯ bulsal (lit. two-people friend) ‘(the) two friends’. As a matter of fact, this is how Mwotlap regularly forms non-singular numbers for all its [+human] nouns, whether of class I or class II: hence na-lq¯ov¯en ‘(a/the) woman’, yoge l¯oq¯ov¯en ‘(the) two women’, t¯elge l¯oq¯ov¯en ‘(the) three women’, ige l¯oq¯ov¯en ‘(the) women’. Notice that in this case, by an effect of structure, the article nareceives a singular reading (which it doesn’t necessarily have with non-human nouns); and the collective, despite being formally the NP head, could well be analysed alternatively as a kind of number article.5 3.2.2.2. The morphosyntax of number. Besides the use of collectives on the noun, number distinctions may be encoded by other formal clues in the sentence, such as the reduplication of certain nouns or adjectives6 (n¯etmey ¯ ‘child’ 4. In other cases, the referent of the collective is already topical (definite) but has been temporarily deactivated in discourse. The difference between collectives and personal pronouns in terms of the cognitive activation of the referent (Givón 1983, Terrill 2001) will appear in (43), with t¯elge ‘the three fellows’ (definite, deactivated) vs. k¯eyt¯el ‘they’ (definite, activated). 5. The singular equivalent of a collective phrase requires a noun as its syntactic head. When the modifier of the collective is itself a noun, then it may alone constitute the head: thus ige l¯oq¯ov¯en ‘women’ corresponds to na-lq¯ov¯en ‘a woman’. But other kinds of modifiers, such as those cited above, must resort to the dummy noun et ‘person’: n-et qagqag ‘a Whiteman’, n-et ta-Franis ‘a Frenchman’, n-et bi-kikbol ‘a soccer player’, n-et mino ‘a relative of mine’, n-et g¯oh ‘this person’. 6. To some extent, reduplication on the verb may also suggest a plural argument (subject and/or object); but this is just one possible reading of plural action – which is what reduplication really codes for (François 2004b).

A typological overview of Mwotlap

125

→ n¯etn¯etmey ¯ ‘children’; su ‘small.sg’ → susu ‘small.non-sg’); the personal pronouns; and the agreement on the verb (only in the case of Aorist: 3sg ni- vs. Ø- elsewhere). (11)

a.

b.

N¯etmey su en, k¯e ni-m¯ ¯ ¯ ol. child small bkg 3sg aor.3sg-return ‘The small child (he) returned.’ Yoge n¯etn¯etmey susu en, k¯oy¯o ¯ coll.du child.dup small.dup bkg 3du (Ø-)m¯ ¯ ol. aor(non3sg)-return ‘The two small children (they) returned.’

Conversely, non-human referents formally neutralise all number distinctions. As a consequence, all Class II nouns but three are invariant with respect to number: e.g., ne-vet means ‘stone’ or ‘stones’. In (12), the whole sentence is grammatically treated as singular, and only cultural knowledge reminds us that the cooking stones used in the Melanesian earth oven actually count in dozens: (12)

m¯ok ne-vet l-ep t¯o k¯e ni-vey. G¯en 1inc.pl aor.put art-stone loc-fire then 3sg aor.3sg-red.hot ‘We lay the stone(s) on the fire till it gets (i.e., they get) red-hot.’

Non-human nouns are not compatible with collectives (*ige vet), and are treated as singular even in the presence of a numeral: e.g., ne-vet v¯et¯el ni-vey ‘(lit.) the three stone gets red-hot’; see also (9). 3.2.2.3. The animacy hierarchy. This morphosyntactic split, which Mwotlap seems to have brought to an extreme, can be found in other Oceanic languages, and is not totally absent from other parts of the world. In such languages as Georgian (Hewitt 1996: 53) or Classical Greek, plural inanimate subjects take singular agreement on the verb; and Mundari (Austro-Asiatic; Bhattacharya 1976: 191–192) restricts number marking to animate referents. While these languages draw the categorial boundary with respect to the feature [animate], in Mwotlap what is relevant is humanhood. However, the essential point here is to note that all these languages satisfy the universal tendency known as “plurality split” (Smith-Stark 1974). If a language treats differently two sets of nouns, then those which are sensitive to number will be to the left of the following “animacy hierarchy” (Corbett 2000: 55–66), whereas those to the right will tend to neutralise number: human > animate > inanimate referential > inanimate generic

126

Alexandre François

Once again, the cognitive ground for this tendency derives from the high degree of discreteness that is characteristic of human referents. Conversely, the lower individuation typical of non-human beings explains why they tend more naturally to be coded as mass nouns: compare with English cattle, furniture, vegetation, food, which are coded as singular whatever the actual quantity. 3.2.3. Possession. The grammar of possession is complex in Mwotlap (François 2001b: 419–632), but it is similar in outline to many other Oceanic languages (Lichtenberk 1985). Regardless of their distribution between Class I and II (Section 3.2.1), nouns are divided into two watertight classes with regard to possession. On the one hand, there is a closed set of about 125 inalienable nouns. They require a possessor to be overtly present immediately to their right, in the form either of a personal suffix (see Table 3), e.g., na-y¯ne¯ -k ‘my legs/feet’, or of a postposed (unprefixed) possessor noun, e.g., na-y¯no tarak ‘the wheels of the car’. For these nouns, the absence of a possessor would be ungrammatical: *nay¯no (?‘a foot’). Semantically speaking, inalienable nouns refer to relational notions, such as kin terms (t¯eta-n ‘his sister/her brother’, e¯ gn¯o-n Sera ‘Sera’s spouse’), body parts (na-mn¯e-k ‘my arms/hands’, n¯e-lwo bago ‘shark teeth’), part terms (na-lo e¯ m ¯ ‘inside of house’, na-yo q¯et¯enge ‘tree leaves’) and other relational terms (na-he-k ‘my name’, na-tno-n ‘his/her/its place’).7 On the other hand, all other nouns form an open set of alienable terms, which can appear unpossessed, e.g., n-¯em ¯ ‘a/the house(s)’. The possessor, if present, cannot be added directly; instead, this requires the mediation of a linker which receives the possessive morphology, e.g., n-¯em ¯ no-NO-ng¯en ‘our house’. To be precise, this linker must be chosen from among a set of four morphemes according to the semantics of the relationship involved. These four possessive classifiers are (here in their 3sg form): na-ga-n ‘food possession’, na-ma-n ‘drink possession’, no-no-n ‘general possession, stable relationship’, na-mu-n ‘temporary possession, relationship restricted to a particular situation’. (13)

Nu-suk g¯oh na-mu-k, ba na-ma-nm¯oy¯o. art-sugar here art-tempp-1sg but art-drinkp-2du ‘This sugar is mine (to buy), but it’s for you (to drink with).’

For complex reasons, the syntax of alienable nouns seems to be currently gaining ground over inalienable patterns. Thus the inalienable form ive-n ‘his 7. What is even more interesting for the typologist is probably the list of exceptions to these semantic motivations. For example, all body products (blood . . .) and internal parts (guts, liver . . .) are treated as alienable, because they are physically or conceptually separable from the body. See the discussion in François (2001b: 440–465), as well as contributions in Chappell & McGregor (eds.) (1996).

A typological overview of Mwotlap

127

mother’, now obsolete, has been replaced by the formally alienable phrase tita no-no-n (originally a term of address, ‘his mum’). Similarly, compare ni-hyimem ‘our strength; (formerly) our bones’ with the more innovative pattern nihiy no-no-nmem ‘our bones’. This evolution is much stronger in Mwotlap than in any other language in the area. These boundaries between types of possessed nouns are in turn cross-cut by formal contrasts between different categories of possessors. If we take the example of the inalienable noun (na-)he ‘name’, we observe a morphological difference between, on the one hand, the use of personal suffixes if the possessor is [+human] [+referential] (e.g., na-he-k ‘my name’; na-ha-n na-lq¯ov¯en ¯ the unsufg¯oh ‘the name of this woman’); and on the ¯other hand, the use of fixed form of the possessed noun if the possessor is either non-referential (e.g., na-he l¯oq¯ov¯en ‘a woman’s name’), non-human (na-he v¯on¯o g¯oh ‘the name of this village’), or both (na-he v¯on¯o ‘a village name’). Once again, the grammatical categories of Mwotlap have remarkably crystallised what is fundamentally a cognitive difference of perception between human specific referents – which are highest on the scale of individuation – and all the rest. 4.

The mechanics of predication

A complete sentence may lack any argument phrase (see Section 5.1), but it cannot lack a predicate. For a language like Mwotlap, the syntax and semantics of predication involve more diverse patterns than the sole tense-marked verbheaded predicate. First, not all predicates involve Tense–Aspect–Mood (TAM) inflection; second, even those which are inflected this way can take other parts of speech than the verb as their head. 4.1. Four basic predicate structures 4.1.1. Direct noun predicates. Direct noun predicates cover both equative predicates strictly speaking (the subject X is identified as coinciding with a known item Y, e.g., X is the doctor) and ascriptive predicates (the subject X is ascribed to a set defined by the notion Y, e.g., X is a doctor). In both cases, the clause structure simply juxtaposes two well-formed NPs {Xnp Ynp }:8 (14)

Imam mino t¯eyt¯eyb¯e. father my healer ‘My father is a healer; My father is the healer.’

8. The following examples will signal the boundaries of the predicate phrase with pointed brackets . . ..

128

Like most Austronesian languages, Mwotlap lacks any copula: it is a property of nouns, as a part of speech, to be directly predicative (see Lemaréchal 1989, Launey 1994). If the predicate head belongs to Class II (see Section 3.2.1), then it must bear its article. Incidentally, given that non-human arguments are normally substituted by zero anaphora, it is frequent to hear sentences that consist of only one noun phrase, the predicate: (15)

a.

Y¯oy! Na-naw! excl art-salt.water ‘Yuck! This is salt water!’

The same observation holds for possessive classifiers (Section 3.2.3), which form a subset of inalienable nouns. Thus the single word Na-kis [art-foodp. 1sg] forms a perfectly complete sentence ‘That’s mine (to eat)’; see also (13). Negating a noun predicate requires the negation et- . . . te, still with no need of a copula (see also (2)): (15)

b.

te. Et- na-naw neg1 art-salt.water neg2 ‘This is not salt water.’

We will come back to noun predicates in Section 4.1.4.3. 4.1.2. Locative predicates. Locative predicates locate a subject X in space or time. Once again, in the absence of any copula, the predicate is constructed directly {Xnp Yloc } X is at location Y. This predicate can be any well-formed locative phrase (see Section 5.3): (16)

a.

Ithi-k Ostrelia. same.sex.sibling-1sg Australia ‘My brother is in Australia.’

Based on this locative construction, the anaphoric adverb a¯e ‘there; on/for/ with . . . it’ (see 38) provides the standard pattern for existential predicates (there is X), and hence for existential possessive predicates (there is my X, usual Mwotlap equivalent for English I have X): (16)

A typological overview of Mwotlap

Alexandre François

b.

Ithi-k a¯e. same.sex.sibling-1sg aa (i) ‘My brother is/was there.’ (ii) ‘I have a brother.’ (lit., there is my brother)

129

4.1.3. Other direct predicates. Apart from nouns and locatives, a handful of lexemes are also able to form a predicate directly (i.e., without any extra morphology): e.g., it¯ok ‘[be] alright’ (20), yeh ‘[be] far’, hayt¯ey¯eh ‘[be] sufficient’, as well as numerals: (17)

Yeh meh. be.far too.much ‘It’s too far.’

(18)

Ithi-k v¯et¯el. same.sex.sibling-1sg three ‘I have three brothers.’ (lit., my brother is three)

To this category of direct predicates, one could add certain linkers and subordinators, e.g., qele ‘[be] like’, veg ‘[be] because’: (19)

Qele le-pn¯o n¯on¯om. like loc-village your ‘It’s like in your country.’

(20)

so n-eh it¯ok. te Et-veg neg1 -because neg2 compl art-song be.good ‘It’s not because the song is nice.’

4.1.4. Tense–Aspect–Mood predicates. The last type of predicate consists in characterising a subject X with a state of affairs or property P, in such a manner that P is assigned to a particular situation, is presented in its time perspective, and comes endowed with a certain modal value. This can be called a “Tense–Aspect–Mood predicate”; it is easily recognisable through the presence of a TAM marker (Section 4.2). As we shall see, these predicates may have not only a verb as their head, but also an adjective or a noun. 4.1.4.1. Verbs in TAM predicates. Being the head of a TAM predicate is practically the only syntactic position a verb may take in a sentence (but see Section 5.2.2). A verb without a TAM marker does not form a valid predicate: (21)

a.

b.

Imam ne-mtiy. [*Imam mitiy.] father sta-sleep ‘Dad is sleeping.’ Imam me-mtiy. father pft-sleep ‘Dad has fallen asleep.’

The syntax of verb-headed predicates will be further detailed in Section 5.

130

Alexandre François

4.1.4.2. Adjectives in TAM predicates. Adjectives, which otherwise differ from verbs in their ability to modify nouns (3.2), share with verbs this property of mediate predicativeness: contrary to nouns and other direct predicates, adjectives can only form a predicate if they are combined with a TAM marker. Generally, but not necessarily, this marker is the Stative ne-. (22)

a.

N-¯el¯e-y ne-ml¯egl¯eg. art-hair-3pl sta-black ‘Their hair is black.’

The Stative9 ascribes a stable property to the subject at a given point in time, regardless of any aspectual or temporal boundaries. Conversely, other markers, like Perfect me- or Apprehensive tiple, will put this property in a time perspective, endowing it with aspectual limits and/or with a marked modal value: (22)

b.

c.

N-¯el¯e-y me-ml¯egl¯eg. art-hair-3pl pft-black ‘Their hair has turned black/has darkened.’ N-¯el¯e-y tiple m¯el¯egl¯eg. art-hair-3pl appreh black ‘Their hair might turn black.’

This mechanism has important semantic implications, as the stative property ‘[be] black’ now reads as a dynamic process ‘darken’. The capacity for adjectives to combine with just the same TAM markers as verbs explains why the lexicon of Mwotlap manages not only without a stative copula (English be), but also without any dynamic copula (English become, turn). Indeed, the notion of quality change present in our verb become or in our change-of-state verbs (e.g., darken) here simply results from the combination of an adjective with a non-stative aspect. We shall come back to this crucial point in Section 4.2.4. Rather than considering that TAM predication turns adjectives into verbs, it is probably more correct to say that adjectives can be inflected in Tense– Aspect–Mood just like verbs, without ceasing to be adjectives.

A typological overview of Mwotlap

4.1.4.3. Nouns in TAM predicates. The same observations apply to the set of nouns, which also appear to be perfectly compatible with all TAM markers. Certainly, this special sort of noun predicates is statistically limited, as most TAM predicates take a verb as their head (Section 4.1.4.1), and most nounheaded predicates are constructed directly (Section 4.1.1). However, the combination of nouns with TAM markers is well attested in Mwotlap (François 2003a: 47–75). It takes place whenever an essential property – which is what nouns fundamentally code for – is seen as unstable with regard to aspect or to modality (e.g., X has become a N, or X might be a N. . . ). (23)

K¯e mal et liwo. 3sg cplt person big ‘He’s already (become) an adult.’

(24)

K¯oy¯o ma-tayak k¯e, t¯o k¯e ni-¯ent¯e-y¯o togolgol. 3du pft-adopt 3sg then 3sg aor-child-3du straight ‘They have adopted him, so that he (became) their legitimate son.’

(25)

nok leg mi N¯ek te-lq¯ov¯en t¯o en, togt¯o 2sg cf1 -woman cf2 bkg then.cf 1sg aor.married with n¯ek. 2sg ‘If you were a woman, I would marry you.’

Once again, it would be arbitrary – or ethnocentric – to stipulate that the nouns10 et ‘person’ or lq¯ov¯en ‘woman’ must have been converted into verbs (through zero-derivation?) before being able to enter a TAM predicate. It seems closer to truth, and in fact more challenging for linguistic theory (Nordlinger & Sadler 2000), to suggest that TAM inflection is just not a privilege of verbs, and can equally affect verbs, adjectives, or nouns in Mwotlap. And still, to say that these three parts of speech merge in the same predicate slot does not mean they are not easy to distinguish in other distributional contexts. 4.1.4.4. The limits of TAM predication. Not all types of predicates may take TAM inflection. For example, locatives are not TAM-compatible: (26)

9. We follow here the usage among aspect typologists (e.g., Comrie 1976: 10) of designating with an uppercase letter the name of a formal category in a given language (e.g., “the Perfect me- of Mwotlap”), as opposed to the semantic concepts relevant to the typology of aspect (e.g., “the crosslinguistic properties of perfect”). Needless to say, a vernacular category labeled Perfect (or Stative, etc.) in a given language does not necessarily match all the properties of the general, supposedly universal, concept of the same name.

131

*Ithi-k mal Ostrelia. same.sex.sibling-1sg cplt Australia *‘My brother’s already in Australia.’

10. Notice that, unlike in direct noun predicates (15a, b), Class II nouns here appear in their bare form, without the article na-. This is consistent with the semantic function of na- (Section 3.2.1).

132

A typological overview of Mwotlap

Alexandre François

This point underlines the necessity to distinguish between the predicativeness of a given part of speech vs. its TAM-sensitiveness (François forthcoming a). For example, the category of locatives is predicative (16) but not TAM-sensitive (27); nouns are both; and so on.

4.2. Semantics of Tense-Aspect-Mood After this syntactic presentation of Mwotlap predicates, we shall present here the most notable characteristics of the TAM system with regard to the semantics of its markers (François 2001a, 2003a). The paradigm of Tense–Aspect– Mood contains, in all, twenty-six markers, fourteen of which are morphologically discontinuous but semantically non-compositional: e.g., me- ‘Perfect’, me-. . . t¯o ‘Preterite’; te- ‘Future’, te-. . . t¯o ‘Counterfactual’, te-. . . v¯eh ‘Potential’. Mwotlap has no auxiliary. 4.2.1. Affirmative vs. negative TAM. While most languages possess a separate negation morpheme which combines with TAM markers, in Mwotlap the polarity feature is included in the semantics of each TAM category. Thus, te-. . . is ‘Affirmative Future’, and contrasts with tit-. . . te ‘Negative Future’. Other languages also contrast affirmative vs. negative tense markers, e.g., Fula (Arnott 1970). But what is even more striking is the general mismatch between the nineteen affirmative and the seven negative TAM, due to many markers being polysemic. Thus the single category of (affirmative) Prospective k¯e so ni-mtiy ‘he’s going to sleep; he should sleep . . .’ (see Section 4.2.3) is negated sometimes by the Negative Future (k¯e tit-mitiy te ‘he won’t sleep’), and sometimes by the Prohibitive (k¯e nitog mitimtiy ‘he mustn’t sleep’). Conversely, several semantic distinctions that are made in affirmative clauses merge in negative contexts. For instance, such diverse sentences as Stative (21a) k¯e ne-mtiy ‘he’s sleeping’; Perfect (21b) k¯e me-mtiy ‘he’s fallen asleep’; Preterite k¯e me-mtiy t¯o ‘he’s been sleeping’; Aorist k¯e ni-mtiy ‘he slept . . .’ are all negated in the same way, with Realis Negative k¯e et-mitiy te ‘he’s not sleeping; he hasn’t slept; he didn’t sleep . . .’. These semantic overlaps between affirmative and negative markers account for the system’s asymmetrical architecture (Table 4). 4.2.2. Aspect without tense. It is in fact problematic as to whether the domain of tense is at all grammaticalised in this system. Indeed, if we see tense as encoding the deictic relationship between the reported state of affairs and the situation of utterance (Comrie 1985: 14), then it appears that the markers of Mwotlap are fundamentally ambiguous in this respect.

133

Table 4. The twenty-six TAM categories of Mwotlap affirmative Completive mal . . . Remote Completive mal . . . t¯o Permansive . . . lapt¯o Stative ne-. . . Perfect me-. . . Preterite me-. . . t¯o Aorist

negative ‘not yet’ negation

et-. . . qete

‘no longer’ negation

et-. . . site

Realis Negative

et-. . . te

Prohibitive

nitog . . .

Negative Future

tit-. . . te

Negative Potential

tit-. . . v¯este

Neg. Apprehensive

tiple tit-. . . te

(ni-). . .

Polite Imperative

(ni-). . . t¯o

Prospective

so (ni-). . .

Hodiernal Future Future Potential Counterfactual Apprehensive Static Presentative Kinetic Presentative Time Focus Immediate Completive Prioritive

te-. . . qiyig te-. . . te-. . . v¯eh te-. . . t¯o tiple . . . . . . t¯o . . . vatag qoyo . . . qoyo . . . e¯ w¯e t¯o (ni-). . . bah en

Ø

For example, the viewpoint suggested by the Completive marker in k¯e mal leg may be anchored in the moment of speech (hence ‘she’s already married’), but it can also perfectly correspond to a past (‘she was already married’) or a future situation (‘she’ll be already married’), without any change in form. In other words, mal indicates nothing more than Completive aspect (‘be already married’) with respect to any anchoring situation retrievable from context. The same demonstration could be made for the other TAM markers of the system: their situational anchoring is always anaphoric, not deictic. To put it differently, we may say that Mwotlap grammaticalises aspect but not tense. The only exception to this principle is the Hodiernal Future te-. . . qiyig – in itself a typological oddity (Comrie 1985: 94). All attested examples of this marker are with reference to the present day of utterance (see (2)); this deictic value is no doubt due to the meaning of its components before it was grammaticalised (te- Future + qiyig ‘today’). In summary, Mwotlap brings together in a single paradigm portmanteau morphemes that convey at once aspect, mood, and polarity.

134

Alexandre François

4.2.3. Aspectual polysemy. Certain TAM markers in Mwotlap show surprising polysemy. One example is the Prospective: k¯e so ni-mtiy can mean ‘he’d like to sleep; he’s going to sleep; he’s falling asleep; he must/should/had better sleep; let him sleep!; he was supposed to sleep; he almost fell asleep; if/when he sleeps; for him to sleep’. Despite the variety of meanings, it is not too difficult to figure out the central mechanism behind them: some modal source – the speaker, the actor, or someone else – is aiming at a certain state of affairs as being the expected outcome of the anchoring situation. This fits well with the notion of “prospective” aspect in use among typologists (Comrie 1976: 64). On a more theoretical level, this case illustrates the importance of construing a semantic model which, instead of requiring the describer to choose between “monosemy” and “polysemy”, should precisely allow for their mutual articulation. While the many contextual values of the Mwotlap Prospective (volitional, deontic, imperative, purposive, conditional, frustrative, . . .) do definitely constitute a set of semantically distinct interpretations, this polysemy can be shown to result regularly from the combination of a single, monosemic marker so niwith different syntactic and discourse configurations. A solution to this paradox can be obtained by resorting to instructional semantics: the Prospective asks the addressee to calculate the correct interpretation from the context, through the identification of such parameters as the relevant anchoring situation and the relevant modal source (François 2003a: 218–257). Sometimes, however, the polysemy of a marker defines a unique configuration, which is hard to subsume under a single widely-used name. In this case, the choice of a label for the vernacular category necessarily involves a certain degree of arbitrariness. For example, the term “aorist” is endowed with quite different meanings among aspectologists, depending on the scholarly tradition they belong to. We have chosen to follow the recent usage among French scholars (after Culioli 1978) of giving this name to a marker which is sometimes called “neutral”, “minimal”, “indefinite”, or “zero” aspect, but whose mechanism seems to be more constraining than these terms suggest. What makes Aorist ni- so challenging is its high polyfunctionality (François 2003a: 165–199). It codes for the succession of events whether in realis, irrealis, or fictitious contexts (see (11), (43)); for imaginary or counterfactual statements (25); for generic sentences and procedure descriptions (m¯ok in (12)); for the expression of intent (36), instructions (40), and orders (6b, 7a); for progressive aspect (6a, 35, 42). Finally, it is also the form required with purposive or other irrealis subordination (ni-vey in (12)), as well as realis result clauses (24). A first approximation would tentatively describe this ni- aspect as defining an “immediate new event”, as opposed to the “anticipated new event” expressed by Prospective so ni-. However difficult it may be to define the semantic matrix behind such a polysemy, it can be fascinating to find other languages of

A typological overview of Mwotlap

135

the world with surprisingly similar aspectual polysemies, like the “Aoriste” of Wolof (Robert 1996). 4.2.4. Aspect, actionality, and lexical properties. Among the twenty-six markers of the system, some (like the Stative in (21a)/(22a)) trigger a stative reading of the predicate head; others (like the Perfect in (21b)/(22b)) a dynamic reading. Not surprisingly, inherently dynamic verbs – e.g., van ‘go’, tot ‘chop’, lep ‘take’ – are compatible only with the latter, not with the former: thus van can combine with the Perfect (ma-van ‘has gone’), not with the Stative (*navan).11 Crucially, however, the reverse is not true. Stative notions, which we would expect to be only compatible with stative TAM categories, can in fact combine with any marker. In other words, all lexemes capable of referring to an unbounded property – whether stative verbs (hey ‘wear’, t¯ey ‘hold’), adjectives (gom ‘sick’, w¯e ‘in good health’) or even nouns (welan ‘chief’, bulsal ‘friend’) – are equally capable, with no derivation nor added morphology, of referring to the bounded, dynamic process that results in that same property (resp. ‘put something on’, ‘grab’, ‘get sick’, ‘recover’, ‘become a chief’, ‘make friends’). The regular polysemy of all these words can be shown to follow a single two-phase pattern of the form {event1 + state2 }. This semantic model (François 2001a; 2003a: 346–363), which can be called “Twofold Actionality Pattern”, articulates a [+bounded] initial phase1 (e.g., mtiy ‘fall asleep’, ml¯egl¯eg ‘turn black’) with a [−bounded] resulting phase2 (mtiy ‘sleep’, ml¯egl¯eg ‘be black’). It is then a property of each aspect marker to select either the first (cf. Perfect in (21b)/(22b)) or the second phase (cf. Stative in (21a)/(22a)) in the lexeme’s meaning. In other words, Mwotlap encodes in the grammar certain semantic distinctions which English encodes in its lexicon, such as the contrast between telic fall asleep and atelic sleep, or between put on and wear. This “Twofold Actionality Pattern” hypothesis also proves powerful in accounting for several puzzling features of Mwotlap aspect, such as the “perfectal” paradox mentioned by Sasse (2002: 210): “the perfectal aspect associates a change of state (perfectivity) with its resultant subsequent state (imperfectivity)”. This is how a single form of Perfect can be translated sometimes as a completed action (e.g., he has put my shirt on), sometimes as a present progressive (he is wearing my shirt) – see François (2003a: 82–104). To sum up, the Mwotlap TAM system does not draw a simple boundary between stative and dynamic verbs. Rather, the line is drawn between, on the one hand, some verbs which are exclusively dynamic; and on the other hand, 11. Only reduplication (François 2004b) has the power to change a bounded verb into an unbounded one: e.g., Stative *na-van, but na-vanvan ‘go habitually’. Similarly, compare gen ‘eat s.th.’ in (40), and gengen ‘eat [intr], have one’s meal’ in (43).

136

the vast majority of lexical units (the rest of the verbs, plus all adjectives and all nouns) which are neither inherently stative nor inherently dynamic, but are potentially compatible with both interpretations depending on their morphological marking in the sentence. 5.

Arguments and other complements

We shall outline briefly the syntax and semantics of Mwotlap arguments: subjects (Section 5.1), objects and valency issues (Section 5.2), and oblique complements (Section 5.3). 5.1. Subjects Like most Oceanic languages, Mwotlap lacks a passive voice. In a transitive clause, the subject always corresponds to the active entity (the actor), with no constraint whatsoever upon animacy, definiteness, or hierarchy among persons. Thus, while many languages would hardly allow sentences like A tidal wave hit us or A stone cut my finger, this is perfectly idiomatic in Mwotlap: (27)

Aw¯e! Ne-vet vitwag me-hel na-mn¯e-k! excl art-stone one pft-cut art-hand-1sg ‘Ouch! I just cut my finger on a stone!’ (lit., a stone has cut my finger)

A typical case when an inanimate force acts upon an animate experiencer is the domain of physical feelings and uncontrolled states (hunger, thirst, heat, cold, sleepiness, boredom, giggles, fear, hiccups, sneezing, coughing and all diseases). Once again, the syntax of Mwotlap employs an active pattern here: name of feelingsbj + verb ‘do, touch . . .’ + person affectedobj . (28)

A typological overview of Mwotlap

Alexandre François

No-gom momyiy m-ak no. art-sickness cold pft-do 1sg ‘I have malaria.’ (lit., the cold sickness has done me)

Even weather and “ambient” statements (Chafe 1970: 101) must formally take a subject, e.g., mah¯e (‘place, time’): Mah¯e m¯o-q¯on¯ ‘It’s night’ (lit., the place has [become] night); Mah¯e no-momyiy ‘It’s cold’ (the place is cold). An exceptional case of subjectless sentence appears in (8) M-akteg? ‘What’s going on?’, with the question verb ‘do what’. 5.2. Verb phrase internal structure and valency change Verb phrases are easily delimited by any of the discontinuous TAM morphemes, such as the negations (Table 4). Their internal structure is: TAM1 – predicate head2 – incorporated object3 – serialised verb4 – adjective5 – internal adjunct6 – TAM7 . As we shall see briefly, all these verb modifiers prove capable of affecting the argument structure of their head.

137

5.2.1. Object incorporation. The main case when a noun directly modifies a verb12 is object incorporation. Normally, objects appear as a full NP (Class II nouns taking their article) outside the verb phrase (29a). But sometimes, what is semantically the patient appears as a bare noun within the limits of the VP (see position of Preterite marker me-. . . t¯o): (29)

a.

b.

No m¯e-t¯eq vitwag. t¯o n¯e-m¯es 1sg prt1 -shoot prt2 art-parrot one ‘I hunted a parrot.’ m¯es t¯o. No m¯e-t¯eqt¯eq 1sg prt1 -shoot.dup parrot prt2 ‘I went parrot-hunting.’

Contrary to n¯e-m¯es in (29a), the incorporated object m¯es in (29b) is non-referential, having no other function than to define a sub-type of hunting. What results from this process of object demotion is a new lexical item, an intransitive “macro-verb” t¯eqt¯eq m¯es ‘to parrot-hunt’. The syntax and semantics of object incorporation in Mwotlap are thus identical to what has been observed in other languages (Mithun 1984, Givón 1984: 416). This syntactic structure has two morphological corollaries. For one thing, the reduplication of the verb reflects the shift from a bounded event t¯eq ‘shoot s.th.’ to an unbounded activity t¯eqt¯eq ‘shoot repeatedly > shoot virtually > hunt’ (see Footnote 11). For another thing, the absence of the nominal article na- is consistent with our earlier semantic observations on Class II nouns (see Section 3.2.1). Despite the similarity between this structure and verb compounding, the verb and the incorporated noun still behave as two separate phonological words (Section 2.2.2). Even if new collocations are regularly invented, the incorporating pattern is essentially attested in a limited set of lexical collocations, as often in Vanuatu. As is generally the rule when such lexicalisation takes place (Mithun 1984: 848), the combinations most likely to deserve a lexical status correspond to those activities that are socially relevant in the speakers’ culture. Thus *t¯eqt¯eq qo ‘pig-shooting’ would not make sense in Mwotlap, because there are no wild boars in this part of Melanesia, and killing pigs is not traditionally done by shooting (t¯eq) them, but by hitting them (wuh) with a club. 5.2.2. Serial verbs. A verb head is sometimes modified by another verb or two, hence forming a case of serialised verbs. Despite the wide variety of combinations attested, and the high productivity of this syntactic device, it is pos-

12. A less frequent incorporating pattern allows nouns to indicate the manner of a verb: hohole l¯oq¯ov¯en ‘talk (like a) woman’, et mete-k ‘see (with) my own eyes’.

138

sible to identify two essential functions that can be played by verb serialisation (a third pattern will be mentioned in Section 5.2.3). One is concurrent serialisation, whereby two simultaneous (never sequential) actions are performed by the same subject A (see also (5): ‘see know’): (30)

B¯oyb¯oy m¯e-h¯ew t¯ey me na-mtig. Boyboy pft-go.down hold hither art-coconut ‘Boyboy has brought the coconuts down.’

The second pattern is causative serialisation, whereby a subject A causes B to do something (see also (3): ‘hit dead’; (10): ‘do sad’): (31)

Na-lo me-hey matyak no. art-sun pft-shine be.awake 1sg ‘I was woken up by the sun shining.’ (lit., the sun shone me awake)

The modifying verb in a series is likely to affect the argument structure of its head. For example, (30) shows how a predicate phrase can be globally transitive although its head is intransitive; and (31) illustrates how two intransitive verbs can result in a transitive macro-verb. Incidentally, this possibility of serialising two verbs that share no argument at all constitutes a noteworthy exception to the definitions usually adopted for verb serialisation (Durie 1997: 291). As is often the case throughout Oceania (Crowley 2002: 172, Bril & OzanneRivierre 2004) as well as in other parts of the world (Aikhenvald & Dixon forthcoming), certain particular serialising patterns tend to specialise in the expression of certain grammatical functions. To take just one example, the transitive verb v(e)teg ‘leave someone/something’ is regularly used as a second member in a concurrent serial construction, to code for the comparative: (32)

A typological overview of Mwotlap

Alexandre François

K¯e n¯e-mnay veteg n¯ek. 3sg sta-clever leave 2sg ‘He’s cleverer than you.’ (lit., he’s clever he leaves you behind)

The issues raised by verb serialisation in Mwotlap, especially how it manages each verb’s valency, are discussed in François (2004a, forthcoming b). 5.2.3. Adjectives as verb modifiers. An adjective can modify a verb to indicate the manner of the action: see (6a)–(6b) hohole liwo [speak big] ‘speak loudly’. To the extent that adjectives can be viewed as a subset of verbs (Section 4.1.4.2), this pattern might well be analysed as a third type of serial verb, that is, “event-argument” serialisation (Aikhenvald forthcoming, François forthcoming b): in a sentence like ‘you speak big’, the semantic argument of ‘big’ is not ‘you’, but the subevent ‘your speaking’.

139

Incidentally, this structure accounts for the paucity of manner adverbs (of the type loudly, heavily) in Mwotlap. Indeed, this function is fulfilled by plain adjectives in a serial pattern, with no need of creating adverbs by derivation. 5.2.4. VP-internal adjuncts. Mwotlap does have a class of VP-internal adverbs however, which can appear nowhere else in the clause than as a VP modifier. They are sometimes called “adjuncts” (Crowley 1982: 162) to distinguish them from VP-external adverbs such as locatives (Section 5.3). Examples include lok ‘back’ (3), meh ‘too much’ (17), kal ‘upwards’ (35), tiwag ‘together’, galsi ‘properly’. Some adjuncts historically emerged – or are currently emerging – from verbs in serial constructions, e.g., q¯et ‘run out’ > ‘completely’; t¯ey ‘hold something’ > ‘Comitative’ (30); veteg ‘leave something’ > ‘away from; than’ (32). As is suggested by the latter examples, adjuncts can be transitive. This makes them capable of disrupting the argument structure of the predicate: (33)

a.

b.

Hey na-trausis. aor.wear art-trousers ‘Put some trousers on.’ Hey goy na-y¯ne¯ den ne-nem mi aor.wear (across) art-leg.2sg from art-mosquito with na-trausis. art-trousers ‘Protect your legs from mosquitoes with trousers.’

In (34b), the adjunct goy does not only add to the verb hey its own semantic contribution (V + goy ‘do something in such a way to obstruct, protect, impede, keep away, . . .’); it also entails a complete shift in the argument structure of the VP. To be precise, two analyses could be proposed for (33b). A first approach would describe goy as an applicative, which promotes the beneficiary (na-y¯ne¯ ) to the O function, simultaneously demoting the semantic patient (na-trausis) from the O slot towards the periphery, without fundamentally modifying each participant’s semantic role (Dixon & Aikhenvald 2000). An alternative analysis would consider the sequence hey goy to form a new lexical macro-verb meaning ‘protect something (using a garment)’; in this case, the formal shifting of arguments also implies a semantic reorganisation of the clause, whereby na-y¯ne¯ has become the patient of hey goy, while na-trausis has lost all patient properties and is now a genuine instrument. Both the syntax-oriented and the lexicon-oriented analyses seem to be relevant to account for this sort of adjuncts (François 2000b). The power of reshuffling the geometry of arguments is characteristic of transitive verbs as well as transitive adjuncts. It has been proposed (Crowley 1987: 61, 2002: 52) to analyse such structures {V+Adjunct} as a subtype of verb

140

serialisation {V+V}. This analysis, in our view, unduly forces the facts, for adjuncts like goy do not qualify as verbs. It seems more fruitful to reverse the argument, and describe verb serialisation {V+V} as being just a subtype of a larger pattern of verb expansion {V+x}. This powerful syntactic device, which consists in providing a verb head with certain lexical modifiers in order to build a new macro-verb, may involve verbs as well as adjectives, nouns, or adjuncts (François 2004a). 5.3. Locative and oblique complements 5.3.1. Locatives and directionals. A locative phrase consists of one or more elements, in the following order: a space directional (e.g., hag ‘up’); a Class II noun marked as a locative le- + N (e.g., le-pn¯o ‘in the village’); a locative ¯ adverb (h¯ey¯et ‘in the bush’, amag ‘before’); a place-name (Motlap ‘on Mo¯ talava’); a deictic (e.g., g¯en ‘there’, see Section 6.2.1). Unless they form the predicate itself (Section 4.1.2), locative phrases appear outside the verb phrase. (34)

A typological overview of Mwotlap

Alexandre François

l¯e-tq¯e mino g¯en. No ma-van t¯o hay 1sg prt1 -go prt2 inland loc-garden my there ‘I went to my garden over there inland.’

(36)

5.3.2. Prepositions. Despite taking exclusively human complements, the preposition hiy has primarily a locative meaning: (35)

K¯e ni-yemyem kal van hiy tita nonon! 3sg aor-climb.dup up thither loc mother his ‘He’s climbing on his mother!’

6.

Complex sentences and discourse structure

In Mwotlap, there are two ways for a sentence to be complex. One takes the form of overtly marked coordination or subordination (Section 6.1). The other type is when two syntactically independent clauses appear to form a hierarchy in terms of their pragmatic status or information structure. The key to these constructions is the set of deictic markers (Section 6.2). 6.1. Subordination The clausal complements of verbs of speech, thought, will, and manipulation are introduced by a conjunction so: Iqet ma-galeg [so g¯en so matmat]. (god) pft-do compl 1inc.pl pros dead.dup ‘Ikpwet is the one who made us mortal.’ (lit., Ikpwet made that we should die)

The same morpheme so also introduces reported speech (like wo in (8)), as well as certain conditional and purpose clauses. There is all likelihood that this subordinator so is also the historical source of the Prospective marker so (ni-) (Section 4.2.3), even if both markers are now clearly distinct (cf. 37). Relative clauses use a subordinator (mey) a. The relativised noun has to be explicitly cross-referenced inside the relative clause (here a¯e ‘anaphoric adverb’): (38)

l¯o-q¯on¯ [mey a d¯o me-leg a¯e en] t¯o loc-day the.one sub 1inc.du prt1 -married prt2 aa bkg ‘the day we married’ (lit., the dayi that we married in-iti )

The relativisation strategy also serves to encode the presupposed element in cleft focus constructions: (39)

But most often, this spatial value of hiy receives a figurative interpretation, as it codes for dative or for benefactive:

Nok se n-eh van hiy k¯omy¯o Wemal. 1sg aor.sing art-song thither loc 2du Wemal ‘Let me sing a song to you and Wemal.’

Other prepositions include instrumental-comitative [tiwag] mi ‘[together] with’ (25, 33b); ablative den ‘from (33b), than’; causal veg ‘because of, about’; and a purposive-oblique prefix be- glossed ‘for’.

(37) Mwotlap makes frequent use of its six directionals me ‘hither’ (7, 30), van ‘thither’ (35, 36); hay ‘in’, yow ‘out’; hag ‘up’, h¯ow ‘down’ (43). Horizontal vectors are not encoded by anthropocentric strategies (English right–left, in front–behind, . . .) but by a geocentric system. This four-quadrant system formally employs the same directionals as locally-based strategies, but with different meanings: thus hay ‘in’ – yow ‘out’ serve to encode the topographical axis ‘inland’ (34) – ‘seawards’ (9); and hag ‘up’ – h¯ow ‘down’ encode the cardinal axis ‘southeast [upwind]’ – ‘northwest [downwind]’. Because it is fundamentally based on the topography of islands and on the force of winds, this geocentric system reflects the history of the Austronesian navigators who peopled the Pacific (François 2003b; 2004c).

141

T¯eta-nd¯o [a k¯ey so w¯el k¯e en]. sister-1inc.du sub 3pl pros buy 3sg bkg (lit.) ‘It’s our sisteri that they’re going to marry (heri ).’

142

A typological overview of Mwotlap

Alexandre François

143

Finally, the polyfunctional particle t¯o (+ Aorist) is a subordinator expressing realis result (24) or irrealis purpose (12), as well as a coordinator (‘so, then’) in narratives (8, 43). The semantic contribution of the enclitic t¯o appearing in several aspect markers (see Table 4) is difficult to associate with these clauselinking functions.

tional (25) and other topic clauses (Haiman 1978), in restrictive relative clauses (38), or in cleft constructions (39). When en affects a clause that is syntactically well-formed as independent, one striking effect of information backgrounding is to induce pragmatic incompleteness, and hence discourse dependency or even de facto subordination:

6.2. Deictics and clause hierarchies

(41)

Iqet mi-ti¯n g¯en en, g¯en et-matmat te. (god) pft-create 1inc.pl bkg 1inc.pl neg1 -dead.dup neg2 ‘When Ikpwet created us, death was unknown to us.’ (lit., Ikpwet created us, we were not dying)

(42)

Kimi galeg en, ne-het. 2pl aor.do bkg sta-bad ‘What you’re doing is wrong.’ (lit. You’re doing (it), it’s bad)

6.2.1. Deictics and discourse structure. Deictics in Mwotlap (François 2001b: 280–324) are organised into three degrees: (i) g¯oh ∼ ag¯oh ‘here, this (within the speaker’s sphere)’; (ii) nen ∼ anen ‘there, that (within the addressee’s sphere)’; (iii) n¯ok ∼ g¯en ‘here/there (to which I am pointing, whatever the distance)’. More unusual is the complementary distribution of the two allomorphic series, depending on the pragmatic status of the clause, and the syntactic position of the deictic therein. The “conclusive” forms ag¯oh, anen, g¯en are required if, and only if, the deictic meets the final boundary of an affirmative statement (34). The “non-conclusive” allomorphs g¯oh, nen, n¯ok are normally required in all other syntactic contexts, that is: any position in questions, commands, exclamations, negative statements; and non-final position in affirmative statements, especially topic position (9, 13). Thus compare n¯ok and g¯en in (41): (40)

nok gen mey N¯ek gen mey n¯ok, 2sg aor.eat the.one there[−concl] 1sg aor.eat the.one g¯en. there[+concl] ‘You eat that one, I’ll eat that one.’

A corollary of this mechanism is its demarcative function. While non-conclusive deictics often suggest some sort of pragmatic incompleteness of the clause, their conclusive counterpart marks the end of an assertive utterance. In terms of the management of turn-taking in conversation, this normally coincides with a “transition relevance point” (Sacks et al. 1978) for the addressee. 6.2.2. Discourse backgrounding and clause hierarchies. Another connection between deixis and the organisation of discourse is drawn by the frequent phrase-final clitic en – originally a deictic. Its role is to signal the status of a phrase or clause as being background information, i.e., mental representations that are already present in the discourse or the context, and are supposedly shared by both the speaker and the addressee (Givón 1984: 239–267). Due to this backgrounding property, this marker regularly codes for definiteness and anaphora (9), as well as topicalisation (11). But it may also have a whole proposition in its scope, which makes it almost always present in condi-

The clause hierarchies created by this backgrounding strategy are pervasive throughout Mwotlap speech. Likewise, this clitic en provides the standard way to link events together in narratives: (43)

T¯elge galeg h¯ow n-ep en, t¯o gengen. K¯eyt¯el coll.tr aor.do down art-fire bkg then aor.eat.dup 3tr gengen bah nen en, mitiy. aor.eat.dup finish there bkg aor.sleep ‘The three fellows made a fire and had their meal. [When] they finished up their meal, they fell asleep.’

When used in narratives, en often comes preceded by the deictic nen ‘there, close to you’ (Section 6.2.1), to which en is etymologically related. The “addressee’s sphere” designated by this nen must here be understood figuratively: it stands for the mental representations the addressee keeps receiving from the speaker during their dialogue (cf. uses of là in colloquial French). Hence in (43), nen en could be glossed as ‘there in your mind’, i.e., ‘as you know’. It thus looks as if nen were currently going through the same semantic shift as en evidently underwent earlier, from a spatial deictic value towards a discourse function of information backgrounding, and eventually a syntactic use as a clause linker. This kind of grammaticalisation process recalls how the formal structures of language can be deeply rooted in the pragmatics of face-to-face interaction. 7.

A final note

Of course, just a few pages are not sufficient to draw a comprehensive picture of a language. In order to be described with accuracy, each phenomenon should be discussed and illustrated at length. The characteristics of Mwotlap should

144

Alexandre François

A typological overview of Mwotlap

be compared with other languages, whether on a genetic, an areal, or a typological basis. Whenever possible, diachronic reconstruction should help assess the historical depth of each aspect of the grammar. This is a matter for longer publications, some of which remain to be written. Yet, whilst we had to limit ourselves to the essentials, we also endeavoured to briefly discuss the formal or functional implications of each grammatical structure. It is hoped that this short overview will help the reader situate Mwotlap in some of the debates currently taking place among typological linguists. Received: 2 February 2004 Revised : 9 June 2004

LACITO-CNRS

Correspondence address: Laboratoire des Langues et Civilisations à Tradition Orale, CNRS, 7 rue Guy Môquet, 94801 Villejuif, France; e-mail: [email protected] Acknowledgements: My thanks go to Edith Moravcsik, Isabelle Bril, and three anonymous reviewers of Linguistic Typology, for their comments and advice on earlier drafts of this paper. During the five years I have dedicated to the description of Mwotlap, I benefited from the financial support of the Ecole Normale Supérieure, of the Académie Française, and of my research team of CNRS-LACITO. Finally, my warmest thanks are due to my friends of Motalava who taught me their language: Haget, Moses, Edgar, Milton, to name but a few. Abbreviations: aa anaphoric adverb, aor Aorist, appreh Apprehensive, art article, bkg background marker, cf Counterfactual, coll collective, compl complementiser, cplt Completive, drinkp drink possession, du dual, dup reduplicated form, emph emphatic pronoun, 1exc first exclusive, excl exclamative, foodp food possession, imp imperative pronoun, 1inc first inclusive, hf Hodiernal Future, loc locative, neg (realis) negation, pft Perfect, pl plural, polit polite imperative, poss possessive classifier, proh Prohibitive, pros Prospective, prt Preterite, quot quotative marker, rever reversive, sg singular, sta Stative, sub subordinator, TAM Tense–Aspect–Mood, tempp temporary possession, tr trial, voc vocative pronoun.

References Aikhenvald, Alexandra (forthcoming). Serial verb constructions in typological perspective. In Aikhenvald & Dixon (eds.) forthcoming. Aikhenvald, Alexandra & R.M.W. Dixon (eds.) (forthcoming). Serial Verb Constructions: A Crosslinguistic Typology. Oxford: Oxford University Press. Arnott, David W. (1970). The Nominal and Verbal Systems of Fula. Oxford: Oxford University Press. Bhattacharya, Sudhibhushan (1976). Gender in the Munda languages. In Philip Jenner, Laurence Thompson, & Stanley Starosta (eds.), Austroasiatic Studies: Part I (Oceanic Linguistics Special Publication, 13), 189–211. Honolulu: University Press of Hawaii. Bril, Isabelle & Françoise Ozanne-Rivierre (eds.) (2004). Complex Predicates in Oceanic Languages: Studies in the Dynamics of Binding and Boundness. Berlin: Mouton de Gruyter. Casali, Roderic F. (2003). [ATR] value asymmetries and underlying vowel inventory structure in Niger-Congo and Nilo-Saharan. Linguistic Typology 7: 307–382. Chafe, Wallace L. (1970). Meaning and the Structure of Language. Chicago: Chicago University Press.

145

Chappell, Hilary & William McGregor (eds.) (1996). The Grammar of Inalienability: A Typological Perspective on Body Part Terms and the Part-Whole Relation. Berlin: Mouton de Gruyter. Comrie, Bernard (1976). Aspect. An Introduction to the Study of Verbal Aspects and Related Problems. Cambridge: Cambridge University Press. — (1985). Tense. Cambridge: Cambridge University Press. Corbett, Greville (2000). Number. Cambridge: Cambridge University Press. Crowley, Terry (1982). The Paamese Language of Vanuatu. (Pacific Linguistics, B-87.) Canberra: Australian National University. — (1987). Serial verbs in Paamese. Studies in Language 11: 35–84. — (2002). Serial Verbs in Oceanic: A Descriptive Typology. Oxford: Oxford University Press. Culioli, Antoine (1978). Valeurs aspectuelles et opérations énonciatives: l’aoristique. In J. David & Robert Martin (eds.), Actes du colloque sur la notion d’aspect, 182–193. Metz: Klincksieck. Dixon, R. M. W. & Alexandra Aikhenvald (eds.) (2000). Changing Valency: Case Studies in Transitivity. Cambridge: Cambridge University Press. Durie, Mark (1997). Grammatical structures in verb serialization. In Alex Alsina, Joan Bresnan, & Peter Sells (eds.), Complex Predicates, 289–354. Stanford: CSLI. François, Alexandre (1999). Mouvements et clonages de voyelles en motlav: Entre phonologie et morphologie. Bulletin de la Société de Linguistique 94-1: 437–486. — (2000a). Vowel shifting and cloning in Motlav: Historical explanation vs. formal description. In Marian Klamer (ed.), Proceedings of AFLA 7 (The Seventh Meeting of Austronesian Formal Linguistics Association), 49–68. Amsterdam: Vrije Universiteit. — (2000b). Dérivation lexicale et variations d’actance: Petits arrangements avec la syntaxe. Bulletin de la Société de Linguistique 95-1: 15–42. — (2001a). Gabarit de procès et opérations aspectuelles en motlav, Océanie. Actances 11: 145– 175. — (2001b). Contraintes de structures et liberté dans l’organisation du discours: Une description du mwotlap, langue océanienne du Vanuatu. Doctoral dissertation, Université Paris-IV Sorbonne. 3 volumes. Available at http://alex.francois.free.fr — (2003a). La sémantique du prédicat en mwotlap (Vanuatu). (Collection Linguistique de la Société de Linguistique de Paris, 84.) Paris: Peeters. — (2003b). Of men, hills and winds: Space directionals in Mwotlap. Oceanic Linguistics 42: 407–437. — (2004a). Chains of freedom: Constraints and creativity in the macro-verb strategies of Mwotlap. In Bril & Ozanne-Rivierre (eds.) 2004, 107–143. — (2004b). La réduplication en mwotlap: Les paradoxes du fractionnement. In Elizabeth Zeitoun (ed.), Les langues austronésiennes (Faits de langues, 24), 177–194. Paris: Ophrys. — (2004c). Reconstructing the geocentric system of Proto Oceanic. Oceanic Linguistics 43: 1– 32. — (forthcoming a). Diversité des prédicats non verbaux dans quelques langues océaniennes. In Jacques François & Irmtraud Behr (eds.), Les constituants prédicatifs et la diversité des langues: Actes de la Journée de la Société de Linguistique de Paris. (Mémoires de la Société de Linguistique de Paris.) Louvain: Peeters. — (forthcoming b). Serial verb constructions in Mwotlap. In Aikhenvald & Dixon (eds.) forthcoming. Givón, Talmy (1984/90). Syntax: A Functional-typological Introduction. 2 volumes. Amsterdam: Benjamins. Givón, Talmy (ed.) (1983). Topic Continuity in Discourse: A Quantitative Cross-language Study. Amsterdam: Benjamins. Greenberg, Joseph H. (1963). Some universals of grammar with particular reference to the order of meaningful elements. In Joseph H. Greenberg (ed.), Universals of Language, 58–90. Cambridge, Mass.: MIT Press. Haiman, John (1978). Conditionals are topics. Language 54: 564–589.

146

Alexandre François

Hewitt, George (1996). Georgian: A Learner’s Grammar. London: Routledge. Launey, Michel (1994). Une grammaire omniprédicative: Essai sur la morphosyntaxe du nahuatl classique. Paris: CNRS. Lemaréchal, Alain (1989). Les parties du discours: Syntaxe et sémantique. Paris: Presses Universitaires de France. Lichtenberk, Frantisek (1985). Possessive constructions in Oceanic languages and in ProtoOceanic. In Andrew Pawley & Lois Carrington (eds.), Austronesian Linguistics at the 15th Pacific Science Congress (Pacific Linguistics, C-88), 93–140. Canberra: Australian National University. — (2000). Inclusory pronominals. Oceanic Linguistics 39: 1–32. Lynch, John, Malcolm Ross, & Terry Crowley (2002). The Oceanic Languages. Richmond: Curzon. Mithun, Marianne (1984). The evolution of noun incorporation. Language 60: 847–894. Moravcsik, Edith (2003). A semantic analysis of associative plurals. Studies in Language 27: 469– 503. Nordlinger, Rachel & Louisa Sadler (2000). Tense as a nominal category. In Miriam Butt & Tracy Holloway King (eds.), Proceedings of LFG 2000, 197–214. Stanford: CSLI. Robert, Stéphane (1996). Aspect zéro et dépendance situationnelle: L’exemple du Wolof. In Claude Müller (ed.), Dépendance et intégration syntaxique: Subordination, coordination, connexion, 153–161. Tübingen: Niemeyer. Sacks, Harvey, Emmanuel Schegloff, & Gail Jefferson (1978). A simplest systematics for the organization of turn taking in conversation. In Jim Schenkein (ed.), Studies in the Organization of Conversational Interaction, 7–55. New York: Academic Press. Sasse, Hans-Jürgen (2002). Recent activity in the theory of aspect: Accomplishments, achievements, or just non-progressive state? Linguistic Typology 6: 199–272. Smith-Stark, T. Cedric (1974). The plurality split. Chicago Linguistic Society 10: 657–671. Terrill, Angela (2001). Activation levels in Lavukaleve demonstratives: Oia versus foia. Linguistic Typology 5: 67–91.

             Alexandre François lacito-cnrs, paris \Q^_&&`|Q|\†‡\ Q|&\" \&Q Qˆ\QˆQ`Q ‰Š`‹ "QQ ``QŒ"$‘’ Q&&QQ Q\Q^“\^”" †Q   Q ``   | Q  `\ " \ && \ Q    \   Q `‘ Q\Q`‘\`Q\ †Q`Q•  " "  \& \`QQ& \ & "   Q"   ‘\\"\\`Q †Q&` –" Q\•— \\  Q \\   &&  Q \"QQ&& %\&\‘ &Q`\Q&\ Q``Q"Q" ``\\&"Q\•`\`Q   Q Q Š \ Q Q `Q&  Q Q&&

1. INTRODUCTION 1.1 HISTORICAL EXPANSION OF VOWEL INVENTORIES. ‡`‘ "QQŒ‘"QQ\$‘’POc Q`$˜™Q‘š$™š Q\&&`| Q`QQ ^›QQŠ`‹

"QQQ`Q Q&^”&& Q|\†&`QQŠ`\\Q" Œ^“`Q&"ˆ œQ "&& Q ^ †Q\&`‡&Q       š’’” $  ž  ‡"\|Q|œŸ\ ž‘š\  ‹‹•\ \‹Q| ‹\Q’\ ‹   \""\Q``

†Q\ \Q ` ``"\QQ\& QŒ\ ¡ ‹˜ž^¢¢£Q&&‹"` ¤ \‹"¦ž˜§` “ " ¨ & ™ & ª ’ | \‹"`¦ž˜%&  ‹ Q ‘†& \ Q`š\&^££\ †^¢_” ‡`\\‹"Qš\&\$^£¢” Q ¨\¤"Q` \ ¦ \           "#$ %&Q\

0 

03

4 

4

 

"5

"

,'68+1+ %

6,

',,

0.1,2

33#



"+, "-. - *+$

"# "/ / )

"#$% "&

 ! "'(

 



 

.' . " ,,6#7

 













 

TORRES

I S.

     





 

BANKS

I S.

The Languages of Northern Vanuatu

the history of the vowels of northern vanuatu languages

445

`Q•"&Q\"QQ"ˆQ\‘ ^  ×_\^” ×£"`Q ’Q```&` Q^_&&`|Q \&Q&&Q‘‘ \Q``Š`| †Q`\\ ^

&Q"QQ\ˆQ&&¨"`Q  %Q&QŠ`"&Q&& Q†\|‡\ Q  \ˆ\‘ &&QQ"Q````\` ˆ Q"Q`Q ›Q‡``QŒQ& ``Q&& \Q"\Q` QQ•Q&&`  †Q&QQ`` ‡Q^_&&`|Q†\| &`&Q`QQ–Q&& —™QQ\&‘ \\`&&`Q "QQŠ TABLE 1. THE SEVENTEEN LANGUAGES AND THEIR VOWEL SYSTEMS† lgg

name

no. spkrs location

code no. v

IU



^



hiw

£

TG

‘†&

”

 †&

lht

£¯

vowel inventory  ­ 2®  Œ  ± ­®  Œ

HI

Q

“

‰ ``

tql

£

¯ d d± d d­ d®  ± ´®  

HR

Q` 

› ``

urr

£¯^

 ± µ® ¯d

LW

"

^

‹

mlv

_

‹TP

‹"`

^ £

‹

mlv

_

 +± ® 7 

MG

&

“

™ 

vlr

^

 +± ¶µ·® 7 

RA

¨



› 

vlr

_

RS

¤

^ 

§ 

msn

¢¯^

‹SN

‹"

^

‰ 

msn

_

‹TA

‹



‹

mtt

 _

 +± ® 7 

 +± ® 7   +± µ·¸® 7¯d  +± ® 7    +± ® 7 

™UM

™



™‰¬

tgs

RG

&



§‰¬

wwo _¯^

 +± ® 7 ¯Ö

ªRO

ª

^”

§ ¬

krf

_¯^

 +± ® 7 ¯±d

’LR

’



› ¬

—

× _

 +± ® 7  ¯ Ö +Ö±Ö Ö®Ö 7Ö Ö

KN

|

_

› ¬

lkn

× £

 +± ´® 7  ¯ Ö +Ö ±Ö ´Ö Ö ®Ö 7Ö Ö

‹RL

‹"`

¢

‹ ‰ ¬ mrm

¢¯“

 +± ¬ 2 Œ® 7¯ ±d ®d¬ 7d2

«

¬Q&&¡^QQ‘‡Q``¦  Q &&¨¦“ Q`|¦  &&`Q¦  iso 639-3)\&  ¬\  "QQ\ Œ\¦” Q"`Q \&\`QQ& \&"¦\_ QQ`Q

446

oceanic linguistics, vol. 44, no. 2

`Œ™Q&`&&Q"\`Q&& ŠQ\“  †Q``Q\QŒ Q&Q&`&Q`QQš|^¢£ "QQ\–™Q‘ —Q"QQ–™Q\š —‡š|¨ Q† \|&&"\¹Q™Q&` & "Q&&\QQ " Q`\ \\"Q&`& QQ\&\Q \\Q\```"\‘ &Q†\|&&&” ^  1.2 EMERGENCE OF NEW VOWEL QUALITIES. †Q Q ` \\Q Œ\ ˆ`QQ& ‡"| QŠ`¤ Q""Š`QQŒ‘"` \"ˆŒ& ^º†QQ& QQQˆQŒ"“\ˆ¡ "Q``\Q\\Š \"\ Q\``\Q Q& ’¹ Q`\"|Q&&Q&`\Q &QŠ"Q\Q\\  %\`&"\Q`\ &Q&&Q \&"&&\ QQ œŠ` Q"¤Œ& ^\|& Q‹"Œ&  Q&QQ`Q"‘ \\¹\Q&&  FIGURE 1. FROM FIVE TO NINE VOWELS IN VURËS poc (5 vowels) 

>

modern vurës (9 vowels)

 





¸ +



±

· µ 

7 ®

FIGURE 2. FROM FIVE TO SEVEN VOWELS IN MWESEN poc (5 vowels) 

> 



 

modern mwesen (7 vowels) 

 +

7 ±

® 

“ ¤\`^"Q\`QQ&»d»\&`Q  “ ^ ¤\‹"\&Q\Q&&&–‹—¬   ^¢¢¬\  †Q"†^¢_”¡£¢ "QŠ‘ \\\‹¼` ¤\‹"¼"\ Q&&

the history of the vowels of northern vanuatu languages

447

2. DEFINING REGULARITIES 2.1 MANY REFLEXES FOR A SINGLE PROTOVOWEL. ‹ Œ ` "Œ&Q`Q`\"Q"Q` \ Q \ "  % ` ``Q   Q&   Œ"`\Q&&Q \&&Œ" Q\½Š œŠ` "Q|"Q\"½Q `"¾Š&QŠ½Š  POc¾`]#Q¨¡” ^ POc ] #Q¨¡ IU $] ¦ TG $¦ HI $¦ HR º¦ LW $¦ ‹TP $¦MG $¦RA ¦RS $¦‹SN $¦‹TA $¦™UM ¦ RG $Ö¦ªRO $d¦’LR $¦KN $Ö ¦‹RL ¬$d¬ †QŒ&&\Q&Q&\ ½Š\&&`" ‡QŠ` ¾½\¿À ¿ÖÀ ¿®À

¿±À ¿µÀ ¿±dÀ \¿®d¬À ’ ``\Q\Q "Q&`&& \"\\Œ``&Q"\ |\&`" š `Q`\" Q\`Q&&¡Š` ^"\&&¾ Á ¿®À IU, TG HI ‹SN ¾ Á ¿±ÀLW, ‹TP, MG, RA¦¾ Á ¿µÀRS¦\  Q&`Š&\&\\  Q"`\&¾QŠ½ŠPOc¾`]#&¨¡   POc] #&¨¡IU $] ¦TG $¦HI $¦HR $¦LW $¦ ‹TP $¦MG $¦RA ¦RS $¦‹SN $¦‹TA $¦™UM ¦ RG $Ö¦ªRO $d¦’LR $¦KN $Ö¦‹RL $ †Q`\Q"&&\^``Œ\ && & ¾ Á ¿®ÀIU ¾ Á ¿±À‹TP, ¾ Á ¿µÀRS ¾ Á ¿±dÀªRO  \\Q¡½Š¾\"^\ TG, HI, ‹SN, ™UM, KN, ‹RL ‡Q"\ QŒ\Œ"\Œ\\`½Š &&&"\`\\\Œ\` ½Š&&‘ |`\ "QQ& \&Q"\ & POc¾` Á ¿ÀRA, ™UM¦¾` Á ¿$À"Q  ›Q` Q\Q\&Q$‘’POc¦ QQ|"\&&’ `Œ 

$" \’\^¢¢£  “ ›QPOcŠ`\ ‡Q ``\š|^¢£¦ `` Q``&&\ $˜™Q‘šPNCV "QQQ&&Q|\† ‡\& ” &&\"&&QQ"QŠ Q\ Q``\ ‡&&"QQ½Š¾Q \Q`Q&"\ “ ```ŒŠQ\½Š ›QQQ&\"Q"\QQ\ Q \\\"Q–»—  & ^“ »  %\&\\‡$% "Q"Š` œ "&"\ &&’ \`&&\Q"QQ\‘ \\\`•\¡Q Â& Â\ Â" ÂIdD"Â\`»»

»\» »Ã&» »"» »ÃIdD"» §\ QÂ] Â`"Q‡\uvular flap¼ Q |"\& Q\"QQ"\ \ Q|```‡$%

448

oceanic linguistics, vol. 44, no. 2

 Q\\"QQQ`` Q` 2.2 DEFINING THE CONDITIONING FACTOR. †Q`Š‘     && ` \  ˆ Q \` "`\\\& § "Q\ QQ&QQ\½Š¾"^\ 

Q&&|`º šQ& ¾`]\¾`] |` ˆ|"`&&\Q&&Q"\ \ `ŒQ`\ ’`Q|"Q "Q`"QQ"\ \Q`‘  Q`¾ŠQ¾`]\¾`]¼Q ` \Q&"\Q ¼Q `\QŠ`Q\"^\  %\Q`Q "\``\Q&& "\Q½ QŠ " Q&&&Q" " `Q½"Q "\ " ‡Q|\`Q\Š& _`\ Š` Q`|&" `\ %\  Q&Q\Q^\   ¾``ŠQQ" †Q`Q`QQ|QŠ \&"Q` %\\\ QQ\ QQ&\""\\  ! !  " ‡^\  Q\¾¾`] ¾`]"Q\\\Q`¾ ¾QŠ †QQ`Q"\&&Q‘ && \\\& %Q&Q` \Q| ` Q"&"Q` †Q\` Q½Š¾Q\Q½“ POc¾`#¨   POc ¾|#¨ \POc¾#\ \\¨ “ POc ¾  #¨¡ IU $ ¦ TG $ ¦ HI $ ¦ HR $ ¦ LW $ ¦ ‹TP $ ¦MG $#¦RA #¦RS $ ¦‹SN $ ¦‹TA $ ¦™UM  ¦ RG $Ö ¦ªRO $d ¦’LR $ ¦KN $ ¦‹RL ¬$d¬   POc ¾  #¨¡ IU ¢¦ TG ¢¦ HI ¢¦ HR ¢¦ LW ¢¦ ‹TP ¢¦MG ¢¦RA ¢¦RS ¢¦‹SN ¢¦‹TA ¢¦™UM ¢¦ RG ¢Ö¦ªRO ¢d¦’LR ¢+¦KN ¢¦‹RL ¢

_ ’Š`Q"Q\\"Q•\¡  & ¾#  ` ¨ÁRS $d%!& ÄQ& Q"¾ #&|¨ÁRS %7 œŸ ^¡_”˜__&Q‹"` Q

Q½\¹"

the history of the vowels of northern vanuatu languages

449

 POc¾ #\ \\¨¡IU % ¦TG % ¦HI % ¦HR % ¦LW % ¦ ‹TP % ¦MG %#¦RA %#¦RS %d ¦‹SN % ¦‹TA % ¦™UM % ¦ RG % ¦ªRO % ¦’LR % ¦KN % ¦‹RL % ‡ŠQ\½Š¾Q&& ^ ¾`]\“ ¾` &&`\Q\\¾š "Q  ¾`]\   ¾|&`&Q\¾š £%Q& ¾ Q "QQQ \&\Q\`\¾š  †Q\^|\QQ"&" Q \`Q`|`–Q\• —Q½Š^ "QQ"`"^\ š Q "\–"Q\•—QQ\&& \`Q\ \"Q&\`ŒQ` œ Š` `Q"Q|Q"¾Å &½\»» "Q¾Å\¾ÅQQ\•\»´» †Q `\\&\Q`QŠ` "QQ Q`Q\¹\ “ ‡ Q&\`"^Q"Q &QQ``\Q&&Q\ `\\Q  Q&&\\` \ Qˆ Q"Q "&Q`| 2.3 MAPPING REGULAR VOWEL CORRESPONDENCES. ™" Q Q  ``   Q  \\    `  | Q " `\  Q && | `  ‡ " Q ‹"

Q"Q&Q"\\&Q"Q †Q```\^\‹" &\Q\½ŠQ"‘ Q`&& ª"&QQQ\Œ"`Q‘ Æ  Ç Q^˜   ‰QQ" \Q"Q&&Š` Q&QQQQ Q|\Š †Q Š`& ’ Q\&&& ` \`Q`"‘\Q ‡Q"^\" \ Q\&"  QQQQ\•QÈ ``Q`\&ˆ † “Q"Q&"`\ ‹" §QQ`\\`"•Q`Q& "Q&&``\Š ^ ›QQ|&ˆ  “`\`¼Q‘–œQ &\—¼QQ&& "Q Q\ Q`\ £ †` Q`&Q Q & œŠ` ¤ Q¾š\¾š`\ Q"»µ»\»±»Q`½Š¦\|" ’½¾š»» \»+» §

450

oceanic linguistics, vol. 44, no. 2

3. A FUNCTIONALLY BASED HISTORICAL EXPLANATION. § 

`Q&"Q\  &` Q&\Q &Q“¦Q `Q``\ †Q"Q`Q`¡Q" "Š`Q&\Q^”&&  Q& Q&"ˆ \Q""º 3.1 PROSODIC STRESS AND VOWEL REDUCTION. ‡ Q   `\"Q\½Š `QQ‘ \QQ`Q"\ †Q‹"Š`   Q" ` "Q "  ¾šš  & ½\   šš¦"\Q"

TABLE 2. VOWEL CORRESPONDENCES BETWEEN POC AND MWESEN poc ^ Å

Å

Å

Å

Å

poc v2 Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å Å

msn reflex of^  + + +  + ± ± ± + ±    ® 7 ® ® ® 7  7 7 7 

poc etymon ¾| ¾ ¾|] ¾` ¾‘& ¾ ¾ ¾` ¾]| ¾‘& ¾¿|ÀÃ] ¾|` ¾`\ ¾¹à ¾|] ¾Ã ¾ˆ ¾É]` ¾| ¾ ¾` ¾|` ¾ˆà ¾` ¾Ã`ˆ

msn reflex ¢  ++ "++ +"  ‘| + `` $ `Š `+‘| Ã ¢– $  ¢ |d`"7à    ‘7 – ¢77" 7 "7 Ã"

#`Q¨ #'%¨ #`¨ #&\"¨ #&¨ #"Q¨ #½¨ #"Q¨ #\¨ #\¨ #%` ¨ #` ¨ #*+ ` ¨ #/++¨ #"¨ #&Q¨ #\¨ #\¨ # Q`¨ #Q¨ #"¨ #¨ #¨ #`¨ #¨

TABLE 3. REGULAR VOWEL CORRESPONDENCES FOR MWESEN ¾0 ¾0 ¾0 ¾0 ¾0

¾0  + ± 7 

¾0 + ±  ® 7

¾0 + ±  ® 7

¾0 + ±  ® 7

¾0  + ® 7 

the history of the vowels of northern vanuatu languages

451

" \ ‰Š`^Q"QQ &&&Q¡Q  "Q"`¾| ½\\\&&  †Q`"\\\`Q ‡ `"Q" Q&"`\ "QQ \"\``\ & ¾¥Á%  †Q`& `Q "\1 3 %¿¤|Ö"¥ÖÀÁš  ¿"¥À#¨ ‡QQ&& Q|Q\Q QŒPOcQ\& & #¨¾Ã`ˆÁ ¾Ã`¦Q\"‘ŒŠQ\` Q` \\\‘ "\ & ¾¤Ã¥` "\\"\‘\""\‘Œ ` ¢"QQŠ`"Q"\"Q"& \\"¡Š` ¾¤Ã¥`Á‹SN $¥! †Q"\‘Œ`"Š`"Q Q‘ &&Q "\"\QŒQQQ `Q ¡__ ‰ŠQ\ \œQ¡\Q`&&`"

œQQ`Š&& %Q\"\‘\\" |"`  Q&’&& |"% %\& \ “ –&`Q\Q`‘Š& \ —Q’&` \&™Q‘š  ‡Q" –`&\Q&"Q\ `‘Š \"QQ\—¼\Q– ```"QQ%&& —‡Q``  "Q"Q\QQ†\|&&`\\ Q\ ¬`Q|`&&Q|\ \"Q"\& 3.2 LEXICAL DISTINCTIVENESS AND THE STRUCTURAL ECONOMY OF THE SYSTEM. "\\Q^_&&‘ ` Q&Q"Q&``Q`Q& ‡&& ‹  \`QŠ Q"\"QQ\¼Q\ Œ¼" " Q&Q  Q   »»  »»  †Q `   ¾| #¨ Á ¢    ¾#\¨ Á%  †QQ`QQ"&&\Q&QQ`¼ &

^ ¾`]#Q¨Á$   ¾`]#&¨Á$¼" `\ †Q\``QŠ& Q"Q‹Q|`‘"`" †Q Q"

|Q&&Q Q\`ŠQ^”&&& ‡ Q "\\Q"QŠ "QQˆQ \" †Q "Q&&‹Q\\ ¢ †Q`Œ"\‘\\`"\‘`\

452

oceanic linguistics, vol. 44, no. 2

Q"š¾&šš ‡Q Q "\`QŠ"&&QŠ `‘  Q‹ ‡\\ \QQŠQ\Š "Œ\Q`˜˜˜˜"\& &Q`¾ ‡``` "\Q \&Š\£ ` ™\ Q \QQ`QQ&&"\Q\‘ Q\Q ‡ QQ&&"\"Q Š"Q\ " Q"\` Š\ %Q&QQ\\\ &&Q Q"\Q&¡    %" !4% ’|QŠ`‹" “

\Q`Œ\˜˜˜˜\\ &&¾ Q\˜˜ "QQ Œ`"  ’ "Q" Ë  × `^˜ \\& Q \"ˆ †Q&`Q\" \`Q`Q& "Q ""&\"\&&Q&`Q‘  œŠ` ‹"|"&Q&&Q\Q` Q"&¾Å&\"QQ&¾Å  Q `Q»±» ÄQ\``Q½\|Q Œ‘" †Q`Q"\QŠ``QQ `\"Q&QQ&&\QŠQQŒ \\`Q& \`^“\"ˆ %Q&Q Q\\``Q`Q``& QŠ`‘ "QQ\Q"\ ` †QQ`Q&\Q && ‹¨\5%+  % 46 7 ^¢ "Q‹¬^¢_¡ ¦¡ –’& Q\QQ "\``` `\&"¼&Q Q\ Å &Q ""`Q&\

"QQ`\QQ\""Q`\‘  ‡`Q`|"\`Q‘ Q\``&"" Q"Q`\\Q"\  — ^†Q`Q`Q\Q–‘ ^ –¨ Å  \û   Ì ¨&  \   \   \  ``¨``Ì`ÍÍ\ &ÍÍ\ Í Å‡ÍÍ\`QΈ`

`\ Q\Í ¨`ˆ¹ ÍÍîÍÌ`¨\ˆ\`4 7̨\Œ\\ —

the history of the vowels of northern vanuatu languages

453

`Q&•—&Î&\\^¢_£¼Q Q` Š\&`Q& Q ’QŠ``&" \QQ" \Q‘ &`Q"‘  ^^‡ "Q&\Q\` \QŠ`" ’\‘ Q``§ &QQ ¡"\Q\QQ• &Š  &`QŠ`Q `\&Š "\\Q`’ "Q&‘ ˆ ‡&& Q§Q‰†Q&  ¡_ Q &&QQ ^¡^“˜” Q\\Œ \\"Q\``"`Q š  Q‹ "\\QŠ`" QQ"Q šQ|\\`Q&`Q "^¢ ¢ ¬\&Q^¢¢ ¦"\ª^ \›& ^¢£ ¡ “ 3.3 METAPHONY OR METATHESIS? %Q&Q Q  Š` `Q|QQ"Q  Q`Q& \Š`Q\"QQ``\ ŠQ`Q`" †Q "Q"Q!"" "Q``QQQ&& "Q Š`!Q``\  †Q&`Q|Q¡Q Q``\ `Q"Q"Q`\& †Q ‘|"|`QQ¬&& & Q` `Q&Q"¾&\`\&|" \``& œŠ` Q$‘¬&»``¾Ö #¨ ¾Ö‘•#¨¾%Ö  ¾%8Ö ’\ ‰&Q Q\Q&Q" ‡`Q "\METAPHONY "QQ–`"\¹ ""\—†|^¢¢”¡

^ ‡QQ&& `Q"\ Q\\"\Q`Q¡&  ^|` \``\‘ &Q ‡"|QŠ`¾`]#&¨ Œ&Q `¾$Á¾$ ^ "QŒ¿À\¿À &&\‘ `QQ¿´À¼Q&Q& Q& QŠ Q`Q»»»š» |" |#Q¨¾`]Á¾$"\ Q\`\|Q¿¶À Q¾$Á¾$! ‡\& "Q ^^ %Q’&`\ Q"Q``\Q &&™"š\¡’•‘ \ ^¢£¢" \   ^Q& §^¢¢¡ £˜^Q%&&

454

oceanic linguistics, vol. 44, no. 2

Q`"\\Q`" Q"`Q‘ `Q¿´À\¿¶À`Q•\ Q""ˆ "QQŠ\¾$#&¨ ¾$!#Q¨ ›QQ\Q""`Q&"QQQ\ \&\"QQQ "QQQ&\"QQ" Q"\&&Q Q Š`Q"Q&Š\¾`] ¡¾`]"`\ \&& QQŒ"¼ & TG$ ¡$¦ HI$ ¡$¦ ‹SN$ ¡$¦ KN$Ö ¡$Ö¦ ‹RL$ ¡¬$d¬ ‡Q‘ && "Q"Q`Q&`Q»» "•Q`Q %Q&QQ‡Q`Q\\Q ˆ\Q`Q\"\\&& Q |Q\Œ\Q"\Q` ’ ¬\&Q^¢¢ \Q`Q"‹‘ && ª\šQ| ªQQŒ"Q `Q& QQ"`Q \`\&QˆQ `"¡Š` »šš»¿¥š´šÀ »šš»¿¥š¶šÀ šQ| "\Q`Q&"Q"\‘Œ"¡Q ¬\‘ &Q^“` –Q"|\QŒ" \"Q" `Q\Q\"&•\`Q —¼Š` »´» »¶» †QQ"`Q"&& QšQ|`QŒ" ‡`` Q`QQ`QQ\ˆ"Š`Q Q"Q&Q|`"POc\Q\‘ &&Q ‡"\Q‹"Š` “ " &QQŒ¿À¾#Q¨\Q\"¿À¿7À \``& Q¾Á¾7Á 7¦\QQŒ¿À ¾ˆà Á¾#¨"\¿À¿7À Q¾Á¾7Á7\ %& QQ&`QŠ`\ QŠ`\‘ \¼Q `Q  †QQ`"Q"Q\•‘ `\Q %Q`` &&\% $"`   "\&&`"QQ\ ^¢£_¡ |¾$\Q\&`Q¾$ Á¾$ "\ &Q"Q\¹"¾$Á¾$´ §\‘ QQ&¾$ Á¾$Á¾$¶¦¾Á¾Á 7 ¾Á¾Á7 ^“

^ `\&Q&&\QŠ POc¾]Q\``\&Q &\"Q¾¦&&Q\¾]"Q½Š\ ¾ †Q"Q‡QQ Q|` `¾Q½Š¾]"Q ``&\ %" QQ& Q&¾] Á  ¾` Á $ Å&\Q`\ "QQ" ^“ ™ Q" Qˆ»š» \ˆ&\¯"QQ `"¡ & 4#`` ¨Á4Á4!^¢£_¡ £

the history of the vowels of northern vanuatu languages

455

™QQ"Š`Q&  Q`Q‘ \\ ^ †Q Q QQŠ``""Q&\Q"Q&\ Q`¡Q\Š`Q&Q`QŠ`\ Q¾šÁ š \Q"Qˆ\Œ&Q Q&QQ¾šÁ š  ‡ QQQ\"QQ&`"Q `"Q¾Å¾$ Q\•\&"Q »´»¾$´ ›QQ\Q`Q&|Q Q\\"Q"\¡Q`QQ`Q&& \¾$´ "QQQ¾$ †Q Q"ˆ`Q¼Š`Q`Q `&Q ’ Q\Q`Q` &\Q&\&&¦\‘ `Q\Q`Q 3.4 SHARED OR PARALLEL INNOVATION? †Q\Q‡ Q\\\"QQQQ` \\\ Q Q`‘ `\  Q && Q\ `\  Q Q     ` Q&Q"\Q|`Q&&`  ‡"Q½"&Q&&"\&"Q` Q& œ ""Q`Q " &QQ&|`–$˜†‘|—Q^” &&` \ŠQQ&&^ ^ " QŠQQ\\ œQ ‹Q&&QQ\\&Q&QQ `Q&`Q" "Q&Q`\Š\Q &&` "QQ"\|Q` ^ œQ "\QˆQQ&Q&

"\QQ"QQ&&\"Q` 4 `QQ& QQ"Q&QQ %`Q& ÄQ \&"\&&Q 

\Q`&"QQ\\‘ |QQ\‘Q`Q\Œ\ ‡ `‘ `&&``&Q&&Q†\|" \\Q Q`Q&\\"Q& "\QŠ\\Q`Q\

^ ‡Q &`Q`Q\&Q  "`\Œ\QQ`Q\QQQ`Q ^¢£_ § “ ^ §&\Q"Q\• `|&& `\‹ "QQ&\&Q`Q& Q`QŠ  & `Œ †%‹| QŠ``\Š 

456

oceanic linguistics, vol. 44, no. 2

%`&\Œ&"Q\•`Q‘ QŠ`Q&`&&‰` §Q‡Q\ %\&¬^¢__ §|QŠ`\\ "Œ^ " \&&Q&Q` \`§|"`\``\Š ^¡ ” "Q\•§|¬^¢__¡ POc¾‘É#Q»Q ¨Á%9¦POc¾‘&# ¨Á%9¢¦ POc¾`‘É#Q»Q Q¨Á¦POc¾`‘&# Q¨Á¢¦ POc¾#Q¨Á9¦POc¾ˆ#\¨Á»¦ POc¾|#\&¨Á¢¦PNCV¾"#¨Á»$9  ›Q&QQ†\|&&\Q "QQ&&§†^¢_”¡£ Q§|¹`` ¬¦Q Q&&§Q&&`QQ| %Q&QQ\"\ˆ\Q&&‘Q`Q

|QQ`"&&`Q&Q&&& \ %Q&\\QQ`"Q\•"Q Q`&"Q`Q|` &&Q ’ Q`Q\`‘ `^_¼Q Q&&`QQ‹ ` §| ^”‡\Œ\"QQ"Q|`QQ\\\ `QQ`\`QQ&Q&&

\§`^¢ ^ `Q`QQ&Q \ –"Q&&¿QÀ& \\Q\ \`\`Q\ `—\ “ Ä QŠ&&" QQ&&&&Q"Q"Q \Q %\\ `¼"QQ\‘ \¼QQ``\¡ \&Q " ›Q\\ Q" QQ& `"QQ\Q&&& œŠ`  | Q\"$d%! +Ï ¾"&Ð^¢^_#``"`Q¨\ + Ï ¾#Q¨Q"Q»»Q&Q"|`

 QQ\•` ^£Q\"Q| "Q&Q Q`\&Qˆ"Q& Q&Q&& šQ QQ‡Q\Q `|"Q¡Q&``Q ^” †|"\& Q&&‹" $ \Q"§ Q \\ &Q&QQ` ™Q\\QQ&&|` \QQ ^_ ‰Š``\\–ЗQQQ ``\``\Š ^£ †Q  Q& Q`Q  \  Q Š  Q   LKN % ! Ï ¾|‘#¨4 Ͼ‘#|"Q&¨” ^ “

the history of the vowels of northern vanuatu languages

457

&\\QQŒ‘"`QQ\‘ && ›QQ&&Q&\"Q| \ Q`ŒQQQ \Q&&` %Q&QQ|\Q` Q`\ ‡Q"&"Q \Q 4. CROSS-LANGUAGE DIVERSITY. †QQ‹" Q&\ “"Š`¹Œ\`\Š`  †QQ&&\‹"QQˆ\ˆ "&QQ`Q\• œQ‘ && ¹`Q`\&\ "Q\ Q\ QQ\`\`Q\`QQ& &"Qˆ`Œ` 4.1 CROSS-LANGUAGE DISCREPANCIES. †Q Q\& `\  “\\‹"|`QQ&" `\  Q &&  Q `  †Q ^_ Q     ``\Š ^  Ñ |  Q  \  Q Q  \& " &Q&Q"&& †&"Q ‡"Q‘ &&Q Q&Q\&‹"Q"`\ \ ˆQ\ †QŠ&&Q Q` " ‹"`

&  \ ™   \\  "&  Q  `  ‹"  œ   Q  Q   `" ^˜   & ½\&Q`QQ&"È¡¾š^š ÁšÈš  š`\ Q" ```\Š`Q` " ``\"QQ–"‘Q\—"‹" œŠ`

Q¾Å½\Q&& Q"»±»¼“ "`\& ¾^Å"Q"½Š \Q\ |` †Q`QŠ¾^Å‹"Æ  + ® 7  Ç\ "Æ  + ± +  Ç¡ _ ¾^Å&½\"Q¿¯À¿¯`\À""¡ POc ¾‘&#&&¨Á $#‘Š&¨¦ PNCV ¾#"¨Á++%¦POc ¾]# ¨Á¦ POc ¾#\¨Á+$d%!+ #Q¨¦POc ¾`] #"¨Á ‡\Q&&‘`Œ\` \‘ &Q\‘‘ œŠ` "‘ &¬^¢__§| \&&QVLW¾\¾Œ&\ &| \\"Q¾‘ÓQ\•&"QQ `\&\" ¤\\\Q`\& "Q` ‡Q\`\ \\"»µ» »·» »¸» †QQQ

458

oceanic linguistics, vol. 44, no. 2

Q^¾»»"QQ&Q ›Q^"\\\ "Q&Q ¾ QQ&`\\"Q¡ £ ¾^Å&½\"Q¿¯À¿¯\\À"¤¡ POc ¾Ã#&Q¨Ád4!$¦POc ¾ˆ]#†Q ª Q¾Å\¾Å&&Q \`QQ&»±d»\"\ ^\  Q\Q"\ »±»  ”$d$ †QQˆQ"QQ\ `\ ’QQ\ `|Q" `\ "Q¾Å\`QQ&»±d»\`  \`Q»±»"Q¼“^‹"` Q \\Q &QQ\`QQ&`Q »±d»ª¿±dÀ\"\ \`QQ&¿±ÀQ‘ Š¼Q"Q|¿±$±d$À"\\\Q \&»±d$±d$» †Q\\\ \ ‡Q&"\\Q\``Q&

ª "\ Q  \  Q &`  –— &&  ‹"` Q"  ` ¡  Š`  Q \`\   »±d» #|¨ Ï $™š¾# |"¨¿±±dÀ "Q`\&»±d±d» %``\¤ "Q\`QQ&»d»\‘ \^\^” ‡¿dÀ\` "Q|Q `QQ&¿ÀQŠ¡ “  š`\"\¿dÀ\\¿À¤¡ PNCV¾# Q¨→ ¾‘Á % d%#&¨ PNCV ¾""#4 ¨→ ¾""‘""Á!»$d%!$d%!d#|\¨ PNCV¾!#Q\¨→ ¾"‘"Á$d%!$d%!d#Q\¨ †"`Q †Q¿À»¿dÀ \\QQQQ&»»\»d»& "\`Q `QQ¿À\¿dÀ &"`Qˆ`Q»d» _ 5.1.2.3 Asymmetries related to vowel length. œ Œ\`Q‘ & Q&Q"&QQQ\`QQ&  žª ‹"` \ ¤``QQ&Q\`QQ& "\‘` Q&"»Ö»&"Q Q"\ £†Q Q\`|»¢Ö»#¨__¢Ö¢Ö"\ Š`\ ™" "\&QQ œ QQ\ "

»Ö»¿À¿+À §\ \&"\‘Q

_ †Q Q `Q&  ¤ \  Œ Q \  Q Q`Q ‡\\ "Q»d»`\`ŒŠQ%`#prf¨  Q"Q‘ "`QQ&¿À¿+À ¿dÀ¡ & %`¯%d → %%d †Q&& Q¿À\\Q`Q|»dd »`QQ\`

£ †"Š` Q" \``\Š ¡Т^%Ö Ö"ÏÒ¿ À#* 4

  ¨¦Ð^  Ö$ Ö$ÏÒÃÃ#&ŒQ¨

the history of the vowels of northern vanuatu languages

469

&&"\‘†& Q ‹"` ª ¤ Q ½Š\QQ\"\ š` ¾|#¨ Á¢Ö "Q““¾||Á¢Ö¢+ ““ %½Š¾Å\¾Å&¡ POC¾]`]`#&¨ Á¾$$ÁÖ$+$ POC¾||#¨ Á¢Ö¢+ ÒÐ^“ #"¨ Á Ö + Ò¿"À¿"À¢Ð^ #Q¦|¨Á%Ö" +¢ ‡& Q&Q&Q""‘Q\Š&& &

¿¥À#Q\¨ Q`&»Ö»"\‘\"\ ¡¿¥Ö$+$À 5.2 DEALING WITH WORD-INITIAL SYLLABLES. § Q\‘ Q\Q\`4  "    % +  !+ Q Q"Š&` †Q`   Q\ Q       ˆ Æ\ W ¯ ` WǦ\\\QQ`"QQ"Q&Q \Œ\ QQ``\Š^ ‡Q\Q&QQ\`Q\`‘ \QQ\`¦ \"\‘ 

` ¬Q\`\\Q"\

QQQ`"\"Q`Q&\\ ¼`QŒ †QQQ\Œ\`Q `"Q&\"Q\•\|``\Q‘ Q`"Q œŠ` Q""Q&&½ QŒ»»POC¾`#Q\\¨º “  POC ¾ #Q\ \  &¨¡ IU $@2¦ TG $@Œ@¦ HI $¦ HR º¦LW $77¦‹TP 47¦MG $77¦RA 7¦RS $77¦ ‹SN $77¦‹TA $¦™UM ¦RG ($7¦ªRO $77¦’LR $77¦ KN $7¦‹RL ($77 †Q"&"ŠQ\ `¡ Q&\¦ \``&Q¦  Q"&"¦\ Q" 5.2.1 The pretonic vowel is maintained. ™`& ‹&`‘ \`"`" $ †QŠ`‘ Q``"Q"Q&Q"»»»» "QQ\\Q `Q¹Q&&“  †Q\`Q&Q ""`\ š\& ^££ \ "  Q& †Q "Qš\&\‹TA¢#|"¨Ï POC¾| ˆ Q"‹Q¢&"Q" ’Q` \ ¢Ö ¢#&\¨PNCV¾|¦¢Ö¢#`\¨POC ¾|]¦4 4 Ö4 4 #¨¦!Ö!#&¨¦$Ö$#Q¨

470

oceanic linguistics, vol. 44, no. 2

%`‹ |Q&&QQ&`\Q `" & $7 †Q"Q Q`| ``Q`"Q\•¼\&Q\ "\‘\"QQQ` “ †Q``"|¡ PNCV¾\Ã# + ¨Á d5$+Ö POC¾#'%¨Á + PNCV¾"|]#``ŒQ¨Á¾|d`"¢Ád4!¢Ö POC¾|"#Q|¨Á¾¢Á4¢ POC¾"‘É#Q»Q¨Á d4! POC¾‘É#Q»Q¨Á4  †QQ"&" "QQQQ&&  “ &|¡ “” †Q`"|¡ $‰’¾`]&#* %+¨Á¾$|Á$ POC¾¿"À#À   "\¦ "\¨¡ IU ] !¦ TG !¦ HI !¦ LW ¦ ‹TP !¦MG !¦RA 7!¦RS 7!¦‹SN !¦‹TA ! Ð^ ¢ Ò¢^#` `"\¦`"\ "\Q¨¿POc¾|#&`"\ &Q‘ ¨À¡ IU +»¢¦TG ()¢¦HI ¦LW ¦‹TP ¢¦MG ¢¦RA ¢¦ RS d¢¦‹SN ¢¦‹TA ¢¦™UM ¦RG ¢¦ªRO ¢¦’LR Ö ¦KN ¢¦ ‹RL d Ð^“ Ò¢ # ¨¿POc¾|#&`"\¨À¡IU ¢¦TG ¢¦HR ¢¦LW ¢¦ ‹TP ¢¦RA ¢¦RS d¢¦‹SN ¢¦‹TA ¢¦™UM ¦RG ¢¦ªRO ¢¦ ’LR Ö ¦KN ¢¦‹RL d Ð^“^ Ò¢#¦&`QQ\&¨¡  TG @¢¦ LW ¢¦ ‹ TP ¢¦ RS ¢7¦‹ SN ¢¦ ‹TA ¢¦RG ¢¦ªRO ¢¦’LR ¢¦KN !Ö Ð^“  Ò$  #  |¨¡ TG @$¦ HI 4¦ LW ++4¦ ‹TP 4¦ MG $¦  RA $¦ RS $¦‹ SN –¦‹ TA $¦™ UM $¦ RG Ö$¦ ªRO d$¦KN $¦‹RL 4 Ð^““ Ò  #¿>À `¨ ¿PNCV ¾ # `  Q¨À¡ TG ¦ ‹TP + ¦ RA ¦ RS ¦‹TA ¦RG ^ 7¦ªRO d$» d Ð^“  Ò #`   " Q¯¨¡ TG ¦ HI ¦ ‹TP ¦ ‹TA ¦ RG Ö¦ KN Ö Ð^“ Ò¿À #\¨¡ IU ¦ TG ¦ HI ¢»¦ ‹TP  Ö ¢»¦ MG  ¦ RA  ¦RS  d¦‹SN  ¦‹TA  ¦™UM + + Ð^“” Ò( # ¨¡IU ¦TG ¦HI ¦LW $¦‹TP ¦ RA ¦RS ¦‹SN ¦‹TA  ¦™UM  ¦RG Ö¦’LR  ¦ KN ¦‹RL ¬ ¬ Ð^“_ Ò #`ŒQ  ' 6+*  /7 Q  ¡œ| ‹šQ žQ ^¢£¢ \`Q&`    7

¡_^˜¢¢ ’•‘   œŸ  ^¢_”      %66  +Ž6 [Œ 6+\>* %4  7   z7 &\ $ˆ $¡§ÍÍ\ȉ\&ˆ%Q`&ˆ\œ ’•‘  œŸ \ž‘š\  ^¢£¢ ™•»•¡ "\`\Q™"š\&& ‡ `~ ‡Š      *4  %         ~        \  "\ `  ^“˜“ %|\¡&§™"Ü\ $" %\" ^¢_“ §`$‘’&     ^ ¡^“˜££  ¼¼¼ ^¢_” §"’` `Q\`

504

oceanic linguistics, vol. 44, no. 2

 Q& ªQ ^¢£^ *4 %% ¡"# $   ž‘š\ ^¢£   +'>*   %%%+cèmuhî [Œ6+\ %š‡†’‘\ $¡§‰%œ ¼¼¼  ^ †&\Q™"š\¡†Q Š`šÎQî ‡*+   [+human] [-local] > [-human]

Table 5 summarises all the configurations examined in the previous sections, with the last column providing reference to numbered examples. The letter in bold refers to the participant (either G or T) which aligns formally with the Patient; as the table shows, it is always the one that ranks higher on the hierarchy. Rows with no bolded letter mean there is variation as to which participant becomes the object; the last row refers to a special case, in which an apparently nonhuman recipient was treated formally as if it were human. [+human] [+local]

> [+human] [-local]

> [-human]

G

T

33-34, 50, 57, 59’

T

48-49

G

examples

G

T

35-36, 42-46’, 47’

T

G

40-41, 47

T,G

51-52 T,G T,G

53-56, 59-60 ← (G)

63

Table 5: Mapping corpus examples onto the referential hierarchy

As Table 5 shows, the hierarchy between the three levels is robust. Should the two non-agentive participants belong to separate levels on this scale, the syntax of the clause will systematically reflect the hierarchy, by providing the higher-ranking non-agentive participant (T or G) with the status of core argument (Object), and by expressing the lower-ranking one in a prepositional phrase. This results in a regular alternation between secundative and indirective alignments. When, however, the two participants belong to the same level (either two local persons, or two Linguistic Discovery 10.3:97-124

120

Referential Hierarchies in Araki

non-local persons), no clear hierarchy governs their syntactic behaviour. Both syntactic constructions are accepted. The syntax of Araki three-participant verbs is synthesised in Figure 1, in the form of a decision chart. what kind of threeparticipant verb? 3 ditransitive verbs give – tell – show

send-class  fixed mapping

 variable mapping

relative ranking of T and G on HIERARCHY [local] [human]

T>G

INDIRECTIVE Theme = object Goal = dative

equal ranking

free variation

G>T

SECUNDATIVE Goal = object Theme = oblique

Figure 1: The syntax of three-participant verbs in Araki: a decision chart

A similar construction split is described for Jamul Tiipay, a Yuman language of California (Miller 2001:162). While the basic alignment of ditransitive verbs in Jamul Tiipay is secundative, “it can change to indirective if T outranks G on the person scale” (Malchukov et al. 2010). However, Araki differs from Jamul Tiipay in various aspects: by the absence of ranking between 1st and 2nd person; by the possibility of free variation between alignments in certain configurations; and by the existence of a verb class for which indirective alignment is the only one possible. 5.2 Functional interpretation How can we interpret these results? Why do ‘give’, ‘show’ and ‘tell’ behave the way they do, and why do they behave differently from verbs of the send class? WHO'S AFFECTED? The morphosyntax of Araki ditransitive verbs is thus sensitive to two features of its non-agentlike participants: whether they are [human], and whether they are [local], i.e. directly involved in the speech act. That participant which ranks higher on these two parameters combined will be the verb's object, i.e. align formally with prototypical Patients, whereas the other one will be given a peripheral, non-core function in the form of a prepositional phrase.

Linguistic Discovery 10.3:97-124

François

121

Næss (2004; 2007), dealing with two-participant constructions, showed that Differential object marking (DOM) is best analysed in terms of affectedness. Highly individuated objects, i.e. definite or human or otherwise more salient participants, can be said to be more affected than less individuated ones (Næss 2004: 1202); in her interpretation, this parameter of affectedness is central to the characterisation of objects in a typically transitive clause. In the case of DOM, the contrast is between two kinds of objects, one more and one less individuated, with different degrees of affectedness. I'd like to propose that the complex rules followed by Araki ditransitive verbs also involve degrees of affectedness. Yet instead of involving a contrast between two kinds of objects, the opposition stands here between two different participants, T and G. While the position of object, in this language, is in principle open both to the Theme and to the Goal, in a particular clause they have to compete as to which one will be selected to be the object. The main criterion for that competition is their relative degree of affectedness, i.e. which of those two participants is more like a prototypical object. With transfer events like ‘give’, ‘show’ and ‘tell’, the typical configuration is one where the Theme is inanimate and the Goal is human. In this case, the sentient participant is the more affected and thus the foregrounded participant: this explains why this case will systematically results, in Araki, in the alignment of the Goal with the Patient of monotransitive clauses. When both T and G are human, but one of them is a speech participant while the other is a 3rd person, then the local one is more salient in discourse, and perceived as more affected, regardless of its semantic role. Thus if you show me to your cousin, the more salient participant (me) is the one placed on the foreground, and it will be coded as the object in Araki. If one swaps Theme and Goal (as in show me your cousin), the speech-act participant remains foregrounded, and from the point of view of the speaker the event is still semantically oriented towards himself. Here too, Araki will treat that local participant as more salient, and therefore better suited for the position of object – that is, for the morphosyntactic treatment that would align them with prototypical Patients. Finally, when both the Theme and the Goal rank equally on the scale, it is in principle ambiguous which one will be more affected or foregrounded. If I show my girlfriend to my mother, will my action primarily affect my girlfriend, or my mother? Arguably, both the Theme and the Goal are equally affected in such a case (cf. Siewierska and Van Lier 2011). This is why they can equally claim the status of object in Araki, and show here free variation. TWO CLASSES OF THREE-PARTICIPANT VERBS Interestingly, Araki only makes this competition possible for certain verbs of transfer, but not for others. In an event such as send (s.th., s.o.), the only participant that will always be affected is the Theme, whether it is human or not. This is due to the fact that send refers to an event of caused motion, which does not necessarily entail that the target is reached: an utterance such as (28) I sent a letter to you can be true even if the letter never reached its recipient. With a verb like send, release or praise, the event is always construed from the perspective of the Theme; it is the only participant which can have access to the status of object. This explains why, in Araki, such verbs are excluded from the domain of ditransitive verbs for which the competition between T and G is open. By contrast, the events expressed by the verbs sle ‘give’, varai ‘tell’ and vse ‘show’ all inherently entail the success of the transfer event. These three events encode not caused motion

Linguistic Discovery 10.3:97-124

122

Referential Hierarchies in Araki

but caused possession (see Rappaport Hovav and Levin 2008) – whether literally in the case of ‘give’, or figuratively in the case of ‘tell’ and ‘show’: the main point is that events of giving, telling or showing, are only valid – at least in Araki – if the theme has entered the sphere, whether real or symbolic, of the recipient. In I gave her a present, the recipient is necessarily affected by the event, regardless whether the caused-possession event itself is successful strictly speaking – i.e. whether she did accept the gift or not. In order to be assigned any truth value, these three verbs inherently involve both a Theme and a Goal. In sum, for any given three-participant verb in Araki, it is a requirement that potentially both T and G must be equally affectable for them to be able to compete for object status. In this language, this lexical precondition is only met by three verbs (‘give’, ‘tell’ and ‘show’); these are the only verbs concerned by the syntactic competition for object status, as defined by the relative position of participants in the referential hierarchy.

6. Conclusion The syntax of Araki shows sensitiveness to a number of contrasts in the real world, which it makes available for speakers and hearers to retrieve referents. One first contrast is drawn between three-participant events. Those caused-motion verbs referring to transfer events that are semantically oriented towards the Theme (e.g. send, release…), treat it as the privileged argument, and encode it consistently as an object. Conversely, caused-possession verbs refer to events of transfer which are intrinsically successful (give, show, tell): because their Theme and Goal are potentially equally affectable, they are entitled to compete for the place of object. Another functional contrast is drawn among referents with respect to their inherent ability to be affected by an event. In Araki, these referential splits play a role in two different parts of the system. Monotransitive verbs contrast their Patients based on their referential properties involving features such as humanness, specificity, topicality (Section 3). Likewise, the domain of ditransitive verbs is governed by a hierarchy in which humanness plays a central role, as well as the contrast of person between local and non-local referents (Section 4). Evidently, the specifics of Araki verbal morphosyntax define a system that is typologically original. And yet, its general architecture remains deeply consistent with general tendencies observed elsewhere – including in the present volume – on the role played by referential properties in the grammatical encoding of arguments.

References Andrews, Avery. 2007. The major functions of the noun phrase. Language Typology and Syntactic Description, vol. 1: Clause structure, ed. by Timothy Shopen, 132-224. Cambridge: Cambridge University Press.. Bickel, Balthasar. 2010. Grammatical relations typology. The Oxford Handbook of Linguistic Typology, ed. by Jae Jung Song, 399–444. Oxford: Oxford University Press. Bickel, Balthasar andJohanna Nichols. 2009. Case marking and alignment. The Oxford Handbook of Case, ed. by Andrej Malchukov and Andrew Spencer, 304–321. Oxford: Oxford University Press. Bossong, Georg. 1985. Empirische Universalienforschung. Differentielle Objektmarkierung in den Neuiranischen Sprachen. Tübingen: Narr.

Linguistic Discovery 10.3:97-124

François

123

Branigan, Holly, P., Martin J. Pickering, Simon P. Liversedge, Andrew J. Stewart and Thomas P. Urbach. 1995. Syntactic priming: Investigating the mental representation of language. Journal of Psycholinguistic Research 24/6.489-506. Dixon, R.M.W. and Alexandra Aikhenvald. 2000. Introduction. Changing Valency: Case Studies in Transitivity, ed. by R.M.W. Dixon and Alexandra Aikhenvald, 1-29 Cambridge: Cambridge University Press. Dryer, Matthew S. 1986. Primary Objects, Secondary Objects, and Antidative. Language 62. 808-845. Foley, William A. and Mike Olson. 1985. Clausehood and verb serialization. Grammar inside and outside the clause. Some approaches to theory from the field, ed. by Johanna Nichols and Anthony C. Woodbury, 17-60. Cambridge: Cambridge University Press. François, Alexandre. 2002. Araki. A disappearing language of Vanuatu. Pacific Linguistics, 522. Canberra: Pacific Linguistics. -----. 2003. La sémantique du prédicat en mwotlap (Vanuatu). Collection Linguistique de la Société de Linguistique de Paris, 84. Paris, Louvain: Peeters. -----. 2008. A new Araki-English-French dictionary. Paris: Lacito-CNRS. Haspelmath, Martin. 2005. Argument marking in ditransitive alignment types. Linguistic Discovery 3/1.1-21. -----. 2011. Ditransitive Constructions: The Verb 'Give'. The World Atlas of Language Structures Online, ed. by Matthew S. Dryer and Martin Haspelmath, chapter 105. Munich: Max Planck Digital Library,. [http://wals.info/chapter/105] Heine, Bernd andTania Kuteva. 2002. World Lexicon of Grammaticalization. Cambridge: Cambridge University Press. Hopper, Paul and Sandra Thompson. 1980. Transitivity in grammar and discourse. Language 56.253-299. Jauncey, Dorothy G. 2010. Tamambo: the language of west Malo, Vanuatu. Pacific Linguistics 622. Canberra: Pacific Linguistics. Kihm, Alain. 2000. Wolof Genitive Constructions and the Construct State. Research in Afroasiatic Grammar. Papers from the Third Conference on Afroasiatic Languages, Sophia Antipolis 1996) [Current Issues in Linguistic Theory 202], ed. by Jacqueline Lecarme, Jean Lowenstamm and Ur Shlonsky, 151-181. Amsterdam: John Benjamins. Lazard, Gilbert. 1984. Actance variations and categories of the object. Objects. Towards a theory of grammatical relations, ed. by Franz Plank, 269-292. London, New York: Academic Press. Lichtenberk, Frantisek. 1985. Possessive constructions in Oceanic languages and in ProtoOceanic. Austronesian Linguistics at the 15th Pacific Science Congress [Pacific Linguistics, C-88], ed. by Andrew Pawley and Lois Carrington, 93-140. Canberra: Pacific Linguistics. Malchukov, Andrej, Martin Haspelmath and Bernard Comrie. 2010. Ditransitive constructions: A typological overview. Ditransitive constructions. A comparative handbook. ed. by Andrej Malchukov, Martin Haspelmath and Bernard Comrie, 1-64. Berlin: Mouton de Gruyter. Margetts, Anna. 2007. Three-participant events in Oceanic languages. Oceanic Linguistics 46/1.71-127. Miller, Amy. 2001. A grammar of Jamul Tiipay. Mouton Grammar Library 23. Berlin: Mouton de Gruyter. Næss, Åshild. 2004. What markedness marks: the markedness problem with direct objects. Lingua 114/9-10.1186-1212. -----. 2007. Prototypical transitivity. Amsterdam: Benjamins.

Linguistic Discovery 10.3:97-124

124

Referential Hierarchies in Araki

Rappaport Hovav, Malka and Beth Levin. 2008. The English Dative Alternation: The Case for Verb Sensitivity. Journal of Linguistics 44.129-167. Ross, Malcolm. 2004. The morphosyntactic typology of Oceanic languages. Language and Linguistics 5/2.491–541. Siewierska, A. 2004. Person. Cambridge: Cambridge University Press. Siewierska, Anna and Eva van Lier 2011. Introducing people and topics in Europe and beyond. Paper presented at the workshop for Semantic Role complexes. 4-5 April 2011, Zurich. Silverstein, Michael. 1976. Hierarchy of Features and Ergativity. Grammatical Categories in Australian Languages, ed. by R.M.W. Dixon, 112-171. New Jersey: Humanities Press. Van Gelderen, Elly. 2011. The linguistic cycle. Oxford: Oxford University Press. Vari-Bogiri, Hannah. 2005. A Sociolinguistic Survey of Araki: A Dying Language of Vanuatu. Journal of Multilingual and Multicultural Development 26/1.52-66. Author’s Contact Information: Dept of Linguistics School of Culture, History and Language Australian National University ACT 0200, Australia [email protected]

Linguistic Discovery 10.3:97-124

The dynamics of linguistic diversity: egalitarian multilingualism and power imbalance among northern Vanuatu languages ALEXANDRE FRANÇOIS

$EVWUDFW 7KH7RUUHVDQG%DQNV,VODQGVWZRVPDOODUFKLSHODJRVRIQRUWKHUQ9DQXDWX DUHKRPHWRLQKDELWDQWVDQGWRGLVWLQFWODQJXDJHV:LWKDQDYHUDJHRI  VSHDNHUV SHU ODQJXDJH WKLV UHJLRQ FRQVWLWXWHV DQ H[WUHPH FDVH RI WKH OLQJXLVWLF IUDJPHQWDWLRQ ZKLFK LV W\SLFDOO\ REVHUYHG WKURXJKRXW 0HODQHVLD 7KLV VWXG\ SUHVHQWV WKH OLQJXLVWLF GLYHUVLW\ RI WKDW DUHD H[DPLQHV LWV VRFLDO XQGHUSLQQLQJVDQGRXWOLQHVLWVKLVWRULFDOG\QDPLFV  7KHVHLVODQGVIRUPDQLQWHJUDWHGQHWZRUNZKHUHDYDULHW\RIVRFLDOIRUFHV LQWHUDFW VRPHWLPHV LQ FRQÀLFWLQJ ZD\V $ ORQJ ODVWLQJ ELDV WRZDUG FXOWXUDO GLIIHUHQWLDWLRQ RI ORFDO FRPPXQLWLHV KDV OHG KLVWRULFDOO\ WR WKH OLQJXLVWLF PRVDLFREVHUYDEOHWRGD\7KLVWUDGLWLRQDOIRVWHULQJRIGLYHUVLW\ZDVFRUUHODWHG ZLWKDSULQFLSOHRIHJDOLWDULDQPXOWLOLQJXDOLVP%XWZKLOHWKHVHDQFLHQWVRFLDO DWWLWXGHV KDYH VXUYLYHG WR WKLV GD\ WKH OLQJXLVWLF GLYHUVLW\ RI QRUWKHUQ 9DQXDWX KDV DOUHDG\ EHJXQ WR HURGH GXH WR YDULRXV UHFHQW VRFLDO FKDQJHV 7KHVHFKDQJHVKDYHUHVKDSHGWKHODQJXDJHHFRORJ\RIWKHUHJLRQDQGDOUHDG\ UHVXOWHG LQ WKH SDUWLDO ORVV RI HDUOLHU OLQJXLVWLF GLYHUVLW\ :KLOH QRUWKHUQ 9DQXDWXLVVWLOOOLQJXLVWLFDOO\GLYHUVHWRGD\WKHLQFUHDVHGLPEDODQFHRISRZHU DPRQJ ODQJXDJHV SRWHQWLDOO\ PDNHV WKH ZHDNHU YDULHWLHV YXOQHUDEOH LQ WKH GHFDGHVWRFRPH .H\ZRUGV 9DQXDWX7RUUHV,VODQGV%DQNV,VODQGVOLQJXLVWLFHFRORJ\  0XOWLOLQJXDOLVPLQ0HODQHVLDWZRWUHQGVLQFRQÀLFW 6RFLDOQHWZRUNVLQWKHZRUOGDUHSRWHQWLDOO\VXEMHFWWRWZRNLQGVRISUHVVXUHV FHQWULSHWDOIRUFHVZKLFKUHVXOWLQPRUHVRFLDOLQWHJUDWLRQDQGPRUHKRPRJH QHRXVVRFLDOSUDFWLFHV²YVFHQWULIXJDOIRUFHVZKHUHE\LQGLYLGXDOVRUJURXSV HPSKDVL]HWKHLUGLIIHUHQFHDQGWHQGWRGLYHUJHIURPHDFKRWKHU7KHLQWHUSOD\ RIVXFKFRQÀLFWLQJSUHVVXUHVPD\DIIHFWFXOWXUDOSUDFWLFHVDVZHOODVOLQJXLVWLF ±//± ‹:DOWHUGH*UX\WHU

,QW¶O-6RF/DQJ SS࣠±࣠ '2,/LMVO

 $)UDQoRLV EHKDYLRU$FURVVWKHZRUOGFXOWXUDODUHDVGLIIHULQWKHZD\WKH\EDODQFHKRPR JHQHLW\ YV KHWHURJHQHLW\ GHSHQGLQJ RQ DQ LQWULFDWH VHW RI JHRJUDSKLFDO KLVWRULFDODQGVRFLDOIDFWRUV7KXVPRGHUQ(XURSHDQVRFLHWLHVKDYHGHYHORSHG DPDUNHGWHQGHQF\IRUSURGXFLQJFXOWXUDODQGOLQJXLVWLFKRPRJHQHLW\DFURVV YDVW KXPDQ QHWZRUNV WKHUHE\ HUDVLQJ HDUOLHU IRUPV RI KHWHURJHQHLW\$W WKH RWKHUHQGRIWKHVSHFWUXPDQXPEHURIVPDOOVFDOHVRFLHWLHVLQWKHZRUOGVKRZ JUHDWHUWROHUDQFHIRUGLYHUVLW\DPRQJORFDOJURXSV 6PDOOVFDOHVRFLHWLHVDUHHFRQRPLFDOO\VHOIVXI¿FLHQWDQGSURXGO\IRUPWKHFHQWHU RIWKHLURZQVRFLDOXQLYHUVHZLWKRXWQHHGLQJWRGHIHUXQGXO\WRPRUHSRZHUIXORXWVLGH JURXSV7KHLUFRQVWUXFWLYHIRVWHULQJRIYDULHJDWLRQ²ZKLFKKROGVVRFLDOJURXSLQJVWR DVPDOODQGPDQDJHDEOHVL]HDQGNHHSVRXWVLGHUVDWDVXLWDEOHGLVWDQFH²LVQRWRIIVHW E\WKHQHHGWRDOLJQWKHLUODQJXDJHZLWKODUJHQXPEHUVRIRWKHUSHRSOHLQWKHZRUOG (YDQV

6XFK D GHVFULSWLRQ ZRXOG ¿W ZHOO WKH YDULRXV FXOWXUDO DUHDV WUDGLWLRQDOO\ JURXSHGXQGHUWKHWHUP³0HODQHVLD´7KLVPDFURUHJLRQFRQVLVWVW\SLFDOO\RI VPDOOVFDOHHJDOLWDULDQVRFLHWLHVDPRQJZKLFKFXOWXUDODQGOLQJXLVWLFGLYHUVLW\ LVWKHQRUP²LQFRQWUDVWIRUH[DPSOHZLWKWKHSROLWLFDOO\PRUHLQWHJUDWHG VRFLHWLHVRI3RO\QHVLD6DKOLQV/D\FRFN3DZOH\ 7R WDNHDQH[DPSOHIURPLVODQG0HODQHVLDDVPDQ\DVGLVWLQFWODQJXDJHVDUH VSRNHQLQ9DQXDWX7U\RQ/\QFK &URZOH\ IRUDSRSXODWLRQRI DERXW  9162  :LWK RQO\ DERXW  VSHDNHUV SHU ODQJXDJH WKLV FRXQWU\ KDV WKH ZRUOG¶V KLJKHVW OLQJXLVWLF GHQVLW\ SHU FDSLWD &URZOH\   7KLVSDSHUDLPVVSHFL¿FDOO\DWREVHUYLQJWKHG\QDPLFVRIOLQJXLVWLFGLYHU VLW\ LQ WKH 7RUUHV DQG %DQNV ,VODQGV D VRFLDOO\ FRKHUHQW FOXVWHU RI LVODQGV ORFDWHGLQWKHQRUWKHUQSDUWVRI9DQXDWX$VPDQ\DVGLVWLQFWODQJXDJHVDUH VSRNHQLQWKLVDUHDIRUDVPDOOSRSXODWLRQRILQKDELWDQWV7KHDYHUDJH ¿JXUHRIVSHDNHUVSHUODQJXDJHUHYHDOVDQHYHQKLJKHUOLQJXLVWLFGHQVLW\ WKDQZKDWLVIRXQGIRU9DQXDWXDVDZKROH 7KLVH[WUHPHODQJXDJHGLYHUVLW\PD\EHDSSURDFKHGLQWZRGLIIHUHQWZD\V 2QHSRVVLEOHDSSURDFKFRXOGWDNHLWDVDJLYHQDQGREVHUYHLWVYDULRXVOLQJXLV WLFPDQLIHVWDWLRQVWKXVLQHDUOLHUSXEOLFDWLRQV,KDYHHQGHDYRUHGWRGHVFULEH WKHGLYHUVLW\RIWKHVHODQJXDJHV¶SKRQRORJLFDOV\VWHPVRIWKHLUPRUSKRV\QWDF WLFVWUXFWXUHVWKHLUOH[LFRQVDQGVRRQ&RQYHUVHO\UDWKHUWKDQWDNLQJLWIRU JUDQWHG WKLV SDSHU DLPV DW REVHUYLQJ WKLV GLYHUVLW\ IRU LWV RZQ VDNH DQG H[SORULQJ WKH VRFLDO G\QDPLFV ZKLFK XQGHUOLH LW %DVHG RQ YDULRXV ¿HOGWULSV FDUULHG RXW LQ QRUWKHUQ 9DQXDWX VLQFH  , KHUH SURSRVH WR GHVFULEH WKH YDULRXV SDUDPHWHUV ZKLFK VKDSH XS WKLV UHJLRQ¶V ODQJXDJH HFRORJ\ +DXJHQ 0KOKlXVOHU  , ZLOO VKRZ WKDW WKH ODQJXDJHV RI QRUWKHUQ 9DQXDWX DUH VXEMHFW WR WZR FRQÀLFWLQJ WHQGHQFLHV 2Q WKH RQH KDQG WUDGLWLRQDO VRFLDO SUDFWLFHV ² LQ

7KHG\QDPLFVRIOLQJXLVWLFGLYHUVLW\  SDUWLFXODUWKHVSDWLDODQFKRULQJRIVRFLDOJURXSVDVZHOODVHJDOLWDULDQPXOWL OLQJXDOLVP²WHQGWRIRVWHUFXOWXUDODQGOLQJXLVWLFGLYHUVL¿FDWLRQ%XWRQWKH RWKHUKDQGFRQWUDU\IRUFHVDUHDOVRDWSOD\ZKLFKUHVXOWLQSRZHULPEDODQFH EHWZHHQ ODQJXDJHV DQG LQ WKH SRWHQWLDO HURVLRQ RI H[LVWLQJ GLYHUVLW\:KLOH VRPH RI WKHVH OHYHOLQJ IRUFHV PD\ KDYH DOZD\V EHHQ SUHVHQW LQ WKH UHJLRQ RWKHUVKDYHEHHQDFFHQWXDWHGXQGHUPRGHUQFLUFXPVWDQFHVORFDOPLJUDWLRQV DQGFRPPXQLW\PHUJHUVH[SDQVLRQRIWKH%LVODPDSLGJLQDV\PPHWULFDOELOLQ JXDOLVPHVSHFLDOO\LQWKHFRQWH[WRIPRGHUQIRUPDOHGXFDWLRQ 2YHUDOO WKH PXWXDO EDODQFH EHWZHHQ FRPSHWLQJ IRUFHV WKXV DSSHDUV WR FKDQJH LQ KLVWRU\ :KLOH SUHPRGHUQ VRFLHWLHV LQ QRUWKHUQ 9DQXDWX ZRXOG W\SLFDOO\JLYHLQWRSUHVVXUHVRIGLYHUVL¿FDWLRQPRUHUHFHQWFKDQJHVLQWKHLU VRFLDORUJDQL]DWLRQOHDQWRZDUGVWKHHURVLRQLQWKHORQJWHUPRIWKHOLQJXLVWLF KHWHURJHQHLW\WKDWKDVVXUYLYHGXQWLOWRGD\  7UDGLWLRQDOIRUFHVRIOLQJXLVWLFGLYHUVLW\ 7KLVVWXG\ZLOOEHJLQZLWKDEULHISUHVHQWDWLRQRIWKHODQJXDJHVLWXDWLRQLQWKH %DQNVDQG7RUUHV,VODQGV,ZLOOWKHQLOOXVWUDWHKRZWKHOLQJXLVWLFKHWHURJHQHLW\ REVHUYDEOH WRGD\ FDQ EH H[SODLQHG PRVWO\ E\ ORQJVWDQGLQJ VRFLDO DWWLWXGHV ZKLFKDUHFRPPRQLQWKLVSDUWRI0HODQHVLD  7KH7RUUHVDQG%DQNV,VODQGVDPRVDLFRIODQJXDJHV 7KH7RUUHVDQG%DQNV,VODQGVRIQRUWKHUQ9DQXDWXIRUPDUHODWLYHO\VPDOODUHD ZLWKDWRWDOODQGVXUIDFHRINP,WVPRGHVWSRSXODWLRQRIDERXWLV GLVWULEXWHGDFURVVLVODQGVDQGDSSUR[LPDWHO\YLOODJHV(YHQWKRXJKWKHVH FRPPXQLWLHVIRUPWRJHWKHUDUHODWLYHO\FRKHUHQWVRFLDOQHWZRUNWKH\VSHDN GLIIHUHQWODQJXDJHV7KHVHODQJXDJHVDUHDOOFORVHO\UHODWHGVHH6HFWLRQ  \HWKDYHKLVWRULFDOO\GLYHUJHGVRPXFKWKDWWKH\KDYHORVWPXWXDOLQWHOOLJLELOLW\ )LJXUHSURYLGHVDPDSRIWKHDUHDWRJHWKHUZLWKDQDSSUR[LPDWHQXPEHURI VSHDNHUVIRUHDFKODQJXDJH  9DU\LQJ GHJUHHV RI YLWDOLW\ $V WKH VWDWLVWLFV RQ )LJXUH  VXJJHVW WKHVHODQJXDJHVQRZDGD\VHQMR\YDU\LQJGHJUHHVRIYLWDOLW\)RXURIWKHP DUHFOHDUO\PRULEXQGWKH\DUHQRWWUDQVPLWWHGWR\RXQJHUJHQHUDWLRQVDQ\PRUH DQG DUH RQO\ UHPHPEHUHG E\ D KDQGIXO RI HOGHUO\ VSHDNHUV 0ZHVHQ ZLWK DERXWVSHDNHUVLVJLYLQJZD\WRWKHORFDOO\GRPLQDQWODQJXDJH9XUsV7KH WKUHHVSHDNHUVRI2OUDWKDYHVKLIWHGWR/DNRQWKHPDMRUODQJXDJHRQWKHZHVW FRDVWRI*DXD/HPHULJKDG¿YHVSHDNHUVLQDQGKDVQRZJRQHGRZQWR MXVWWZRLQGLYLGXDOVZKROLYHLQDQDUHDVHWWOHGE\0ZRWODSVSHDNHUV$VIRU 9RORZLWLVRQO\UHPHPEHUHGE\WKHVRQRILWVODVWVSHDNHUZKRGLHGLQ

 $)UDQoRLV

7KHG\QDPLFVRIOLQJXLVWLFGLYHUVLW\  7DEOH 6 XUYLYLQJYVH[WLQFWFRPPXQDOHFWVUHSRUWHGLQWKHRUDOWUDGLWLRQRIWKH7RUUHVDQG%DQNV ,VODQGV ,VODQG

6XUYLYLQJFRPPXQDOHFWV

([WLQFWFRPPXQDOHFWV

+LZ 8UHSDUDSDUD 0RWDODYD 19DQXD/DYD 69DQXD/DYD 6*DXD 6:*DXD :*DXD

9RQTǀ /HKDOL 0ZRWODS ‚ /HPHULJ 9HUD¶D9XUsV‚ 0ZHVHQ .RUR'RULJ ‚ 2OUDW 9XUƝ /DNRQ

‚9sT|\|‚9sVsY ‚1WR ‚9RORZ‚'DJPHO ‚3lN‚7RODS ‚:HWDPǀW ‚9LDU ‚7RJOD‚4lWlUHZ

YDU\LQWKHLUVL]HWKH\W\SLFDOO\FRUUHVSRQGWRWKHGLVWDQFHZKLFKDQLQGLYLGXDO FDQHQFRPSDVVZLWKLQKDOIDGD\¶VZDON

)LJXUH 0DSRIQRUWKHUQ9DQXDWXLVODQGVVKRZLQJODQJXDJHVQDPHVZLWKQXPEHUVRIVSHDNHUV

$W WKH RWKHU HQG RI WKH VSHFWUXP 0ZRWODS LV FXUUHQWO\ WKULYLQJ ZLWK DV PDQ\ DV  VSHDNHUV RI DOO DJHV ² DPRQJ ZKRP  OLYH RQ 0RWDODYD LVODQG%\ORFDOVWDQGDUGVWKLVLVDODUJHFRPPXQLW\SHUKDSVHYHQODUJHUWKDQ ZKDWLWZDVLQWKHWKFHQWXU\EHIRUHWKHGHPRJUDSKLFGRZQWXUQRIWKHV VHH6HFWLRQ  %HWZHHQWKHVHWZRH[WUHPHVWKHRWKHU7RUUHVDQG%DQNVODQJXDJHVWHQGWR QXPEHULQWKHKXQGUHGV²IURPIRU/HKDOLWRIRU9XUsV7KHDYHUDJH QXPEHURIVSHDNHUVSHUODQJXDJHLVRULIRQHUHPRYHVWKHIRXUPRUL EXQGODQJXDJHVIURPWKHFRXQW ,QWKLVSDUWRILVODQG0HODQHVLDLWDSSHDUVWKDW MXVW D IHZ KXQGUHG VSHDNHUV PD\ IRUP D YLDEOH VSHHFK FRPPXQLW\ 'HVSLWH ¿JXUHVZKLFKVHHPORZE\ZRUOGVWDQGDUGVPRVWRIWKHVHODQJXDJHVDUHVWLOO KHDOWK\WRGD\EHFDXVH²H[FHSWIRUWKHIRXUPRULEXQGRQHV²WKH\DUHVWLOO WUDQVPLWWHGWRFKLOGUHQ,QWKLVUHJDUGWKH\DUHVDIHIURPLPPHGLDWHHQGDQJHU PHQWVHH&URZOH\  0DQ\RIWKHVHODQJXDJHVDUHVSRNHQE\DVLQJOHYLOODJHRUWZRWKHPD[L PXPLVVL[YLOODJHVIRURQHODQJXDJHDQGWKHDYHUDJHLVWKUHHYLOODJHVIRU ODQJXDJHV 7KHVHYLOODJHVDUHXVXDOO\ORFDWHGRQFRDVWDODUHDVZKHUH¿VK LQJDQGLQODQGUHVRXUFHVFDQHDVLO\EHFRPELQHG:KLOHODQJXDJHWHUULWRULHVDOO

 7KHPHPRU\RIGLDOHFWIUDJPHQWDWLRQ 7KHOLQJXLVWLFIUDJPHQWDWLRQ RIWKHDUHDLVHYHQKLJKHULIRQHFRQVLGHUVWKDWVRPHRIWKHVHODQJXDJHVFRQVLVW RI PRUH WKDQ RQH GLDOHFW 7KXV /R7RJD HQFRPSDVVHV WZR FORVH YDULHWLHV VSRNHQUHVSHFWLYHO\RQ/RDQGRQ7RJD /RFDOSRSXODWLRQVKDYHDOVRNHSWWKHPHPRU\RIDQXPEHURIORFDOVSHHFK YDULHWLHVZKLFKKDYHJRQHH[WLQFWLQWKHODVWIHZJHQHUDWLRQV6RPHWLPHVDIHZ GLVWLQFWLYHZRUGVRUSKRQHWLFFKDUDFWHULVWLFVDUHVWLOOUHPHPEHUHGWRGD\²EXW XVXDOO\ WRR OLWWOH WR HYDOXDWH ZKHWKHU WKHVH YDULHWLHV ZHUH LQGHHG GLDOHFWV RU VHSDUDWHODQJXDJHV,QDFWXDOIDFWSHRSOHXVXDOO\GRQRWGUDZDQ\GLVWLQFWLRQ EHWZHHQ GLDOHFW DQG ODQJXDJH LQVWHDG WKH\ YLHZ DOO VSDWLDOO\ DQFKRUHG OLQJXLVWLFSHFXOLDULWLHVDVFKDUDFWHULVWLFRIDORFDO³ODQJXDJH´WLHGWRDJLYHQ SODFH,QWKLVVHFWLRQ,ZLOOXVHWKHWHUPFRPPXQDOHFWDVDQHXWUDOWHUPIRUDQ\ VSHHFKWUDGLWLRQWLHGWRDVSHFL¿FFRPPXQLW\ 7DEOHOLVWVWKRVHH[WLQFW‚ FRPPXQDOHFWVRIWKH7RUUHVDQG%DQNV,VODQGV ZKRVHH[LVWHQFHLVVWLOOUHPHPEHUHGLQWKHRUDOWUDGLWLRQ2YHUDOOWKH7RUUHV DQG%DQNVLVODQGHUVKDYHNHSWWKHPHPRU\RIGLVWLQFWFRPPXQDOHFWV2I WKHVHDUHVWLOOVSRNHQWRWKLVGD\ZKLOHDUHPHUHO\UHPHPEHUHGIRUWKHLU H[LVWHQFH %HVLGHVRUDOWUDGLWLRQDQRWKHUYDOXDEOHVRXUFHRILQIRUPDWLRQLQWKLVUHVSHFW LVWKHGHWDLOHGVXUYH\SXEOLVKHGE\&RGULQJWRQLQ7KHHDUO\PLVVLRQDU\ OLQJXLVWGHVFULEHVWKHUHWKHOLQJXLVWLFIUDJPHQWDWLRQRIKLVWLPHZKLFKDSSHDUV WREHHYHQKLJKHUWKDQZKDWLVUHPHPEHUHGWRGD\+HUHLVKRZIRUH[DPSOH KHGHVFULEHVWKHLVODQGRI9DQXD/DYD,QWKLVFLWDWLRQ,XQGHUOLQHWKHQDPHV RI FRPPXQDOHFWV ZKLFK DUH VWLOO DOLYH WRGD\ DQG LWDOLFL]HWKRVH ZKRVH H[LV WHQFH LV VWLOO UHPHPEHUHG 1RWH WKH FRUUHVSRQGHQFHV RI ODQJXDJH QDPHV 0RWODY 0ZRWODS9DWUDW 9HUD¶D0RVLQD 0ZHVHQHWF 

 $)UDQoRLV

7KHG\QDPLFVRIOLQJXLVWLFGLYHUVLW\ 

7ZRVPDOOLQKDELWHGLVOHWVOLHFORVHWRWKHHDVWHUQVLGHRQRQH5DYHxDWKHODQJXDJHRI 0RWODYLVVSRNHQRQWKHRWKHU4DNHDWKDWRI0RWD2QWKHLVODQGLWVHOIHDFKRIWKH GLVWULFWVRUJURXSVRIYLOODJHVKDVLWVRZQGLDOHFWYL]3DN/XVD6DVDU/HRQ9DWUDW 9XUDV$YUHDV 0RVLQD/RPULJ1DZRQR$OR7HTHO4DWSH7RODYDQG4H¶L6RPHRI WKHVHDUHQRGRXEWYHU\PXFKDOLNHEXWWKHQDWLYHVWKHPVHOYHVWKRXJKWWKHPGLIIHUHQW DQGEHWZHHQIRUH[DPSOH3DNDQG0RVLQDWKHGLIIHUHQFHLVFRQVLGHUDEOH7KHGLDOHFW RI1DZRQR3RUW3DWWHVRQLVORVWWKHODERXUWUDGHKDYLQJGHVWUR\HGWKHSRSXODWLRQDW RQHWLPHFRQVLGHUDEOH&RGULQJWRQ

7KH ODVW VHQWHQFH RI WKLV TXRWH DOUHDG\ IRUHVKDGRZV WKH GLVFXVVLRQ , ZLOO SURSRVH ODWHU VHH 6HFWLRQ   RQ SRVVLEOH IDFWRUV IRU WKH HURVLRQ RI HDUOLHU OLQJXLVWLFGLYHUVLW\%XWDWWKLVSRLQWRIWKLVVWXG\WKHFUXFLDOREVHUYDWLRQLVWKDW WKHWRWDOQXPEHURIGLVWLQFWFRPPXQDOHFWVUHSRUWHGIRUWKH7RUUHVDQG%DQNV ,VODQGVKDGUHDFKHGGXULQJWKHWKFHQWXU\DWRWDORIDWOHDVW²RIZKLFK KDOIKDYHVXUYLYHGWRWKLVGD\7KLVLQGLFDWHVWKHH[WUHPHGHJUHHRIOLQJXLVWLF KHWHURJHQHLW\ ZKLFK WKUHH PLOOHQQLD RI GLYHUVL¿FDWLRQ ZHUH DEOH WR SURGXFH ZLWKLQVXFKDVPDOOWHUULWRU\  '\QDPLFSURFHVVHVRIFRQYHUJHQFHDQGGLYHUJHQFH $Q RYHUYLHZ RI WKH OLQJXLVWLF GLYHUVLW\ IRXQG LQ QRUWKHUQ 9DQXDWX FDQ EH REWDLQHGE\REVHUYLQJWKHZD\LQZKLFKDUDQGRPVHQWHQFHZRXOGEHWUDQVODWHG LQWRWKHVXUYLYLQJ7RUUHVDQG%DQNVODQJXDJHVVHHQLQ7DEOH 7DEOH /LQJXLVWLFGLYHUVLW\DPRQJ7RUUHVDQG%DQNVODQJXDJHVDQH[DPSOHVHQWHQFH +LZ /R7RJD /HKDOL /|\|S 9RORZ 0ZRWODS /HPHULJ 9HUD¶D 9XUsV 0ZHVHQ 0RWD 1XPH 'RULJ .RUR 2OUDW /DNRQ 0ZHUODS

VLVԥ WDWL M݇MPԥJ‫ݱ‬HQ ZXJ‫ ܵܧݱ‬NZH L QLKԥ WDW OROPԥU‫ܭ‬Q ‫ݛ‬Uȕ‫ܭ‬ N Z‫ܭ‬ H N‫ܭ‬M W‫ܭ‬WQ‫ܭ‬ ܵODO ܵDOV‫ܭ‬ N Z‫ܥ‬ NLࢎ‫ܭ‬M W‫ܭ‬ ܵLODO ‫¡ݹ‬MPDW ‫ܭݹ‬NࢎSZ‫ܭ‬ ƾJܼM ‫ܭ‬W ܵLODO ܵDOVL W‫ܭ‬ƾJࢎEZ‫ܭ‬ NܼM ‫ܭ‬W ܼܵODO ܵDOVL NࢎSZ‫ܭ‬W‫ܭ‬ W U ܼ ܵ‫ܥ‬O‫ܥ‬O ‫¡ݦ‬UPD‫ݦ ݦ‬ NL‫ݦ‬LV QGLU ܼ‫ݦ‬ ODPDL ‫ܭ‬QW‫ܵܭ‬ ‫ܼݦ‬Q QܼU ܼܵWܼ ܵLODO ZDU‫ܵܭ‬ W‫ܭ‬Q QܼU ‫ܭ‬W‫ܭ‬ OܼOܼ PDƾW‫ܭ‬ ȕܼV QUD ܵDWH ܵODOD PDQWDܵ WNࢎSZH QLU ȕLWLV ܵLO OLƾOLƾL PL QܼU V‫ܧ‬ZV‫ܭ‬ ȕUܼܼܵO WDȕXO W‫ܭ‬ QܼU Wܼ U‫ܧ‬ƾ WDȕXO Z‫ݜ‬VP‫ܭ‬O‫ܭ‬ QܼM Wܼ U‫ܧ‬ƾ ȕܼOܼ‫ޝ‬ Z‫ݜ‬VP‫ܭ‬O‫ܭ‬ ܼܵ‫ ޝ‬DWܼ U‫ܧ‬ƾ N‫ܭ‬U‫ܭ‬ Dȕ‫ݜ‬KPDO‫ܭ‬ N‫ܭ‬U WL ȕDOܵ‫ࢎܭ‬DU PܼQPܼQ WܼNZܼW‫ࢎܭ‬D SO 127HDVW9DQXD /DYD@LVORVWWKHODERXUWUDGHKDYLQJGHVWUR\HGWKHSRSXODWLRQDWRQHWLPH FRQVLGHUDEOH´VHHWKHTXRWDWLRQLQ6HFWLRQ  7KHVH FDWDVWURSKLF HYHQWV ZHUH OLPLWHG WR WKH IHZ GHFDGHV DURXQG  +RZHYHU WKH\ ZHUH ODWHU IROORZHG E\ VORZHU GHPRJUDSKLF SURFHVVHV ZKLFK WRRN SODFH WKURXJKRXW WKH WK FHQWXU\ ZKHUHE\ UXUDO IDPLOLHV ZRXOG VHHN ZRUN LQ WKH ZHDOWKLHU FLWLHV RI9DQXDWX QDPHO\ /XJDQYLOOH (VSLULWX 6DQWR  DQG 3RUW 9LOD )RU VRPH LQGLYLGXDOV WKH FLW\ H[SHULHQFH RQO\ ODVWHG D IHZ \HDUVEHIRUHWKH\ZHQWEDFNWRWKHLUKRPHLVODQGEXWIRURWKHUVWKHPLJUDWLRQ WRWKHFLW\ZDVWREHFRPHSHUPDQHQW,QWKHVHIDPLOLHVWKHYHUQDFXODUODQJXDJH PD\ VWLOO EH VSRNHQ IRU RQH RU WZR JHQHUDWLRQV ² WKXV VWURQJ 0ZRWODS VSHDNLQJ FRPPXQLWLHVFDQEHIRXQGLQWKH0DQJRDUHDRI/XJDQYLOOHDQGLQ 3RUW9LOD+RZHYHULWLVFRPPRQIRUXUEDQL]HGFKLOGUHQWRORVHWKHLUYHUQDFX ODULQIDYRURI%LVODPDVHH6HFWLRQ 7KLVEHLQJVDLGWKHSURFHVVRIUXUDO GHSRSXODWLRQ ZKLOH FRPPRQ LQ PDQ\ SDUWV RI WKH ZRUOG LV VWLOO UHODWLYHO\ OLPLWHGLQ9DQXDWXWKHFHQVXVVKRZVWKDWSHUFHQWRIWKHSRSXODWLRQ VWLOOOLYHVLQUXUDODUHDV9162  :KHWKHUWKH\LQYROYHWKHGHSDUWXUHRILQGLYLGXDOVWRIRUHLJQFRXQWULHVRUWR XUEDQDUHDVWKHVHIRUPVRIHPLJUDWLRQFRQVWLWXWHDIDFWRULQWKHGHPRJUDSKLF ZHDNHQLQJRIVPDOOFRPPXQLWLHVDQGWKHSRWHQWLDOHURVLRQRIOLQJXLVWLFGLYHU VLW\%XWLQWHUHVWLQJO\WKHPRGHUQHUDKDVDOVREURXJKWDERXWDQRWKHUIRUPRI PLJUDWLRQ SRSXODWLRQ PRYHPHQWV ZKLFK WRRN SODFH ZLWKLQ WKH 7RUUHV DQG %DQNVDUHDDQGVRPHWLPHVZLWKLQDVLQJOHLVODQG:KLOHWKHVHORFDOPLJUDWLRQV KDYH QRW WULJJHUHG DQ LPPHGLDWH ORVV RI SHRSOH RU ODQJXDJHV WKH\ KDYH UHVXOWHGLQWKHUHVKDSLQJRIWKHVRFLDOODQGVFDSHRIWKHQRUWKHUQDUFKLSHODJRDV DFRQVHTXHQFHWKH\KDYHUHGH¿QHGWKHSRZHUUHODWLRQVDPRQJORFDOODQJXDJHV 7KLVVRFLDOSURFHVVLVWKHREMHFWRIWKHQH[WVHFWLRQ  /RFDOPLJUDWLRQVDQGWKHUHVKDSLQJRIFRPPXQLWLHV 9DQXDWX¶VWUDGL WLRQDOHFRQRP\FRPELQHVWKHKRUWLFXOWXUDOH[SORLWDWLRQRIODQGUHVRXUFHVZLWK SUDFWLFHVRI¿VKLQJDQGJDWKHULQJLQFRDVWDODUHDV7KHKDELWDWWDNHVWKHIRUP VRPHWLPHVRIYLOODJHVRQWKHFRDVWDQGVRPHWLPHVRIVPDOOHUKDPOHWVLQPRXQ WDLQRXVDUHDV3DUWRIWKHOLQJXLVWLFIUDJPHQWDWLRQZKLFKGHYHORSHGLQQRUWKHUQ 9DQXDWX²HVSHFLDOO\DVUHÀHFWHGE\WKHH[WLQFWGLDOHFWVLQ7DEOH²UHÀHFWV

7KHG\QDPLFVRIOLQJXLVWLFGLYHUVLW\  WKLV GHPRJUDSKLF SDWWHUQ RI VFDWWHUHG KDELWDW DV HDFK VHSDUDWH YLOODJH RU KDPOHWKDGGHYHORSHGLWVRZQODQJXDJHYDULHW\ 7KH7RUUHVDQG%DQNV,VODQGVVWLOOFRXQWDQXPEHURIVPDOOKDPOHWVWRWKLV GD\ZLWKVRPHWLPHVMXVWIRXURU¿YHKRXVHKROGVDQGQRPRUHWKDQRU LQKDELWDQWV+RZHYHUDFFRUGLQJWRRUDOWUDGLWLRQVXFKGZHOOLQJSUDFWLFHVZHUH HYHQPRUHFRPPRQLQWKHSDVWDQGKDYHWHQGHGWRGHFUHDVHGXULQJWKHFRXUVH RI WKH WK FHQWXU\ 6HYHUDO KDPOHWV ² HVSHFLDOO\ WKRVH ORFDWHG LQ LVRODWHG PRXQWDLQRXV DUHDV ² EHFDPH GHSRSXODWHG DV WKHLU LQKDELWDQWV UHORFDWHG WR FRDVWDOYLOODJHVVHH9LHQQH 7KLVPLJUDWRU\SURFHVVRIWHQUHVXOWHGLQ WKHPHUJHURIWZRRUPRUHIRUPHUO\GLVWLQFWFRPPXQLWLHVLQWRRQHDQGLQWKH SURJUHVVLYH H[WLQFWLRQ RI VRPH YXOQHUDEOH YDULHWLHV XQGHU WKH SUHVVXUH RI D ORFDOO\GRPLQDQWODQJXDJH 7KH PRWLYDWLRQV IRU VXFK PLJUDWLRQV ZHUH PXOWLSOH (YHQ LQ SUHPRGHUQ WLPHVFRPPXQLWLHVZRXOGUHORFDWHVRDVWRDGDSWWRWKHHYROXWLRQRIWKHLUODQG RUVHDUHVRXUFHVRUZLWKWKHKRSHWRFRQTXHUQHZJURXQGRYHUWKHZLOGHUQHVV RI XQH[SORUHG DUHDV RI WKHLU LVODQG 7KLV LV KRZ IRU H[DPSOH VHWWOHUV IURP 0RWDODYDEHJDQWRFRORQL]HWKHQRUWKHDVWHUQFRDVWRI9DQXD/DYD,RUKRZ 0ZHUODSVSHDNHUVVHWWOHGLQHDVWHUQ*DXDVHH)LJXUH  6RPHWLPHVDSRSXODWLRQQHHGHGWRHVFDSHIURPDQDUHDZKLFKKDGEHFRPH XQVDIH)RUH[DPSOHWKHHUXSWLRQRIWKH*DXDYROFDQRLQIRUFHGWKHUHOR FDWLRQ RI DOO ZHVWFRDVW YLOODJHUV WR WKH 1XPHVSHDNLQJ DUHD IRU WZR \HDUV /LNHZLVHDF\FORQHLQWKHDWROORI5RXDHDVWRI8UHSDUDSDUD IRUFHGLWVVPDOO SRSXODWLRQ WR UHORFDWH SHUPDQHQWO\ WR WKH HDVW FRDVW RI 8UHSDUDSDUD LQ WKH V 9LHQQH    ,Q WKLV FDVH WKH FRPPXQLW\¶V ODQJXDJH ² QRZ /|\|S ² ZDV NHSW DOLYH EXW UHVXOWHG LQ WKH H[WLQFWLRQ RI ‚1WR WKH QDWLYH GLDOHFWRI8UHSDUDSDUD¶VHDVWFRDVW (YHQWKRXJKVRFLDOJURXSVDOZD\VKDGUHDVRQVIRUUHORFDWLQJWKHLUYLOODJHV LW DSSHDUV WKDW WKH ODVW IHZ JHQHUDWLRQV KDYH VHHQ HYHQ PRUH RI WKHVH ORFDO PLJUDWLRQV$VZHVDZDERYHWKHVHULHVRIHSLGHPLFVDURXQGGHSRSX ODWHGYLOODJHVLQSDUWGXHWRWKHDFWXDOGHDWKRIPDQ\RILWVYLOODJHUVEXWLWDOVR SXVKHGWKHVXUYLYRUVWROHDYHWKHLUPRULEXQGLQODQGKDPOHWVDQGMRLQWKHODUJHU YLOODJHVRQWKHFRDVW :KLOHFRQWDFWZLWKWKH:HVWHUQZRUOGKDGEHHQWKHFDXVHRIWKHVHHSLGHP LFVLWZDVDOVRDIXUWKHULQFHQWLYHIRULQODQGHUVWRVHWWOHRQWKHFRDVWDVQHZ FRPPRGLWLHVLURQWRROVPHGLFLQHWUDGLQJRSSRUWXQLWLHV ZHUHFRPLQJIURP WKHVHD7KHORFDOPLJUDWLRQVWKXVKDGDQHFRQRPLFFRPSRQHQW6RPHWLPHV WKLVDWWUDFWLRQWRZDUGVWKH:HVWHUQZRUOGWRRNWKHIRUPRIODERUPLJUDWLRQWR IRUHLJQFRXQWULHVVHH6HFWLRQ EXWRWKHULQGLYLGXDOVFKRVHWRZRUNRQ WKH ORFDO FRFRQXW SODQWDWLRQV IRU FRSUD ZKLFK KDG EHHQ GHYHORSHG LQ WKH FRDVWDODUHDVRIWKHDUFKLSHODJR¶VODUJHULVODQGV9DQXD/DYDDQG*DXD 7KH VHFRQG KDOI RI WKH WK FHQWXU\ VDZ WKH &KULVWLDQL]DWLRQ RI QRUWKHUQ 9DQXDWX E\ WKH 0HODQHVLDQ 0LVVLRQ DQ $QJOLFDQ PLVVLRQDU\ RUJDQL]DWLRQ

 $)UDQoRLV IRXQGHG E\ %LVKRS *HRUJH 6HOZ\Q )R[  +LOOLDUG  7KH 0LVVLRQ FKRVH0RWD%DQNV,VODQGV DVWKHODQJXDJHRI&KULVWLDQL]DWLRQIRULWVELEOLFDO WHDFKLQJVDQGWUDQVODWLRQV)RUDERXWWKUHHJHQHUDWLRQVWKLVFKRLFHUHVXOWHGLQ DQLQFUHDVHGXVHRIWKLVODQJXDJHDFURVVQRUWKHUQ9DQXDWXLVODQGV²DWOHDVWLQ FKXUFKFRQWH[WV+RZHYHUWKHLQÀXHQFHRI0RWDZDVDUJXDEO\PDUJLQDODQG VKRUWOLYHGH[FHSWIRUDKDQGIXORI0RWDORDQZRUGVEHLQJDGRSWHGKHUHDQG WKHUHHJWDWDURµSUD\¶ZRORZRORµDFURVV¶WRWRJDOHµLPDJH¶ LWGLGQRWFDXVH DQ\PDMRUFKDQJHLQWKHOLQJXLVWLFSUDFWLFHVRIWKHSRSXODWLRQV %H\RQGWKHXVHRI0RWDWKH&KULVWLDQL]DWLRQRIWKHDUHDGXULQJWKHSHULRG ௘±KDGRWKHULQGLUHFWHIIHFWVXSRQWKHOLQJXLVWLFODQGVFDSHRIWKHDUHD ²SDUWLFXODUO\WKURXJKWKHZD\LWUHVKDSHGWKHUHODWLRQVEHWZHHQORFDOFRP PXQLWLHV6RPH7RUUHVLVODQGHUVUHFDOOKRZWKHLULVODQGVXVHGWREHGLYLGHGE\ WULEDOFRQÀLFWVDQG¿JKWVXQWLOWKH\ZHUHSDFL¿HGE\PLVVLRQDULHVWKHUHVXOWRI WKLVSDFL¿FDWLRQZDVWKDWIRUPHUO\KRVWLOHFRPPXQLWLHVHYHQWXDOO\PHUJHGLQWR XQL¿HG YLOODJHV$OVR PLVVLRQDULHV SUHIHUUHG WR EXLOG FKXUFKHV RQ FRDVWDO YLOODJHVZKLFKZHUHHDVLO\DFFHVVLEOHWRVKLSV,QODQGHUVZHUHHQFRXUDJHGWR OHDYHWKHLUKDPOHWVDQGMRLQWKHQHZFRPPXQLWLHV+LOOLDUG ZKHUHWKH\ FRXOGKDYHHDV\DFFHVVQRWRQO\WRUHOLJLRXVHGXFDWLRQDQGFHOHEUDWLRQVEXW DOVRWRKHDOWKIDFLOLWLHV 7KHFRPELQDWLRQRIWKHVHYDULRXVKLVWRULFDOHYHQWVH[SODLQVZK\IRUH[DP SOHWKHPRXQWDLQRXVDUHDVRIQRUWKHUQ9DQXD/DYDZHUHVORZO\GHSRSXODWHG GXULQJWKHWKFHQWXU\7KHPDQ\LQODQGKDPOHWVRIWKHLVODQGHDFKRIZKLFK XVHG WR EH FKDUDFWHUL]HG E\ LWV RZQ FRPPXQDOHFW VHH WKH TXRWDWLRQ RI &RGULQJWRQ>@JLYHQLQ6HFWLRQ PHUJHGLQWRWKHODUJHUYLOODJHVRI 9ƝWXEǀVǀLQ9XUsVVSHDNLQJWHUULWRU\ 9HUD¶DDQG0ZHVHQ7RGD\RQO\WZR HOGHULQGLYLGXDOVFDQVWLOOUHPHPEHU/HPHULJWKHODQJXDJHRIWKHLUFKLOGKRRG LQWKHPRXQWDLQV7KHVDPHVWRU\FRXOGEHWROGDERXWWKHKDPOHWVRI2OUDW9LDU 9XUƝRU4lWlUHZZKRVHLQKDELWDQWVDOOPRYHGGRZQWRWKHZHVWFRDVWRI*DXD GXULQJWKHVDQGVDQGPHUJHGZLWKWKHSRSXODWLRQRI-ǀODS /LNHZLVH WKH RUDO KLVWRU\ RI +LZ SHRSOH WHOOV DERXW YDULRXV SURFHVVHV RI YLOODJHUHORFDWLRQVDQGLVODQGLQWHUQDOPLJUDWLRQVDFURVVWKHODVWFHQWXU\)LYH JHQHUDWLRQVDJR+LZLVODQGHUVXVHGWREHGLVWULEXWHGLQWRWHQLQODQGKDPOHWV VFDWWHUHGLQWKHKHLJKWVRIWKHLVODQGDQGVSHDNLQJWKUHHGLIIHUHQWGLDOHFWVRU ODQJXDJHV" ‚9sT|\|LQWKHQRUWK9RQTǀLQWKHFHQWUH‚9sVsYLQWKHVRXWKRI WKHLVODQG$URXQGWKHEHJLQQLQJRIWKHWKFHQWXU\IRUUHDVRQVZKLFKKDYH EHHQ IRUJRWWHQ² EXWZKLFK UHVXOW SUREDEO\IURP WKH GHPRJUDSKLF FROODSVH GHVFULEHGDERYH²WKHWHQYLOODJHVPHUJHGLQWRMXVWWZRYLOODJHVRQWKHFRDVW